KEGG   Mycobacterium sp. MOTT36Y: W7S_05125Help
Entry
W7S_05125         CDS       T02113                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00450  Selenocompound metabolism
mmm00970  Aminoacyl-tRNA biosynthesis
mmm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    W7S_05125
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    W7S_05125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmm01007]
    W7S_05125
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmm03016]
    W7S_05125
Enzymes [BR:mmm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     W7S_05125
Amino acid related enzymes [BR:mmm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   W7S_05125
Transfer RNA biogenesis [BR:mmm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    W7S_05125
 Prokaryotic type
   Other AARSs
    W7S_05125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AFJ34008
UniProt: I2A9N4
Position
complement(1033832..1035376)
Genome map
AA seq 514 aa AA seqDB search
MRPYYVTTAITYPNGDPHIGHAYEYVATDAIARFKRLDGFDVRFLTGTDEHGLKMVETAA
AEGIGTAELARRNSDMFQRLQERLNISFDRFIRTTDPDHHEASKEIWRRMAAAGDIYLDT
YSGWYSVRDERFFVESETRLLDDGTRVAVETGAPVTWTEEQTYFFRLSAYADKLLAHYEA
NPDFIAPEVRRNEVVSFVAGGLRDLSISRTSFDWGVQVPEHPDHVMYVWVDALTNYLTGV
GYPDTDSEMFRRYWPADLHMIGKDIIRFHTVYWPAFLMSAGIELPRRVFAHGFLLNRGEK
MSKSVGNVVDPVALIEEFGVDQVRYFLLREVPFGQDGSFSEEAIITRINTDLANELGNLA
QRSLSMIAKNLGGVLPEPGEFTAADTELLATADGLLERLRASFESQAMHLALEAIWLMLG
EANRYFSAQQPWVLRKSESEADQQRFRTVLYVTCEAVRIAALLVQPVMPESAGTLLDLLG
QAPDQRTFAALDARLTPGTALPPPTGVFPRYQND
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaggccgtattacgtcaccaccgcaatcacctatccgaacggcgatccgcacatcggg
cacgcgtacgaatacgtcgcgaccgacgcgatcgcccggttcaagcggcttgacgggttc
gacgtgcggtttctgaccggcaccgacgagcacggcctcaagatggtggagacggcggcc
gccgagggcatcggcacggccgagctggcccgccgcaattcggatatgttccagcgcctg
caggagcggttgaacatctccttcgaccgcttcattcggaccactgaccccgaccaccac
gaggcgtccaaagagatctggcgccggatggccgccgccggcgacatctacctggacacc
tactcgggctggtactcggtgcgcgacgaacggtttttcgtcgaatcggaaaccagactc
ctcgacgacgggacccgggtggcggtggaaaccggcgccccggtgacctggaccgaggaa
cagacctacttcttccggctctcggcgtatgccgacaagctgctggcccactacgaggcg
aacccggacttcatcgcgcccgaggtgcgccgcaacgaggtcgtcagtttcgtggcgggc
ggcttgcgcgacctgtccatctcgcgcacctcgttcgactggggcgtgcaggtgcccgag
catcccgaccacgtgatgtacgtctgggtcgacgcgctgaccaactacctgaccggggtg
ggctacccggacaccgactcggagatgttccgccgctactggccggccgacctgcacatg
atcggcaaggacatcatccggtttcacaccgtgtactggccggcgtttctgatgtcggcc
ggaatcgagttgccgcgaagggttttcgcgcacggcttcctgctcaaccgcggcgagaag
atgagcaagtcggtgggcaacgtcgtcgacccggtcgccctgatcgaggagttcggcgtg
gaccaggtgcgttatttcctgttgcgggaggtcccgttcggccaggacggcagcttcagc
gaagaggccatcatcacccggatcaacaccgacctggccaacgaactgggcaacctggcc
cagcggtcgctgtcgatgatcgccaagaacctgggcggcgtgctgcccgaacccggtgag
ttcaccgccgccgacaccgaactgctggcgacggccgacggcctgttggagcggctgcgg
gccagcttcgaatcacaggcgatgcacctggcgctggaagcgatctggctgatgctcggc
gaggccaacagatacttttcggcgcagcagccgtgggtcttgcgcaagagcgagtcggag
gccgatcagcagcggttccgcacggtcttgtacgtcacctgcgaggcggttcgcatcgcg
gcgctgctggttcagcccgtcatgcccgaatcggccggcacgctgctggatctgctgggg
caggcgccagaccagcgaacgtttgccgccctcgacgcgcggctgactcccggcacggcg
ctgccgcccccgacgggcgtgttcccccgctaccagaacgactag

DBGET integrated database retrieval system