KEGG   Mycobacterium sp. MOTT36Y: W7S_06165Help
Entry
W7S_06165         CDS       T02113                                 

Definition
(GenBank) hypothetical protein
  KO
K16148  alpha-maltose-1-phosphate synthase [EC:2.4.1.342]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00500  Starch and sucrose metabolism
mmm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    W7S_06165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmm01003]
    W7S_06165
Enzymes [BR:mmm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.342  alpha-maltose-1-phosphate synthase
     W7S_06165
Glycosyltransferases [BR:mmm01003]
 Polysaccharide
  Storage polysaccharide
   W7S_06165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_trans_1_2 Glyco_transf_5 GGDEF_2 DUF3492
Motif
Other DBs
NCBI-ProteinID: AFJ34216
UniProt: I2AA92
Position
complement(1267438..1268610)
Genome map
AA seq 390 aa AA seqDB search
MRVAMMTREYPPEVYGGAGVHVTELVSQLRRLCAVDVHCMGAPRPGAQGVQVHQPDPRLQ
GANAAMTTLSADLLMANAASAATVVHSHTWYTGMAGHLAALLYDVPHVLTAHSLEPLRPW
KAEQLGGGYRISTWVEHTAALAADAVIAVSSAMREDILRVYPALDPGAVHVIRNGVDTDV
WCPAAPSQGESMLAALGVDPDRPLVVFVGRITRQKGVAHLVAAAHRFSPEAQVLLCAGAP
DTPEIAEEIRDAVAGLARARTGVFWIREMLPIGELREILSAAAVFVCPSVYEPLGIVNLE
AMACGAAVVASDVGGIPEVVADGVTGTLVHYDPGDVAGYRAGLAEAVNELVADRGKAQRY
GKAGRQRCVEEFSWAHVAEQTLEIYRKVCA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtggcgatgatgactcgggaataccccccagaggtctacggaggggcgggcgta
cacgtcaccgaactcgtcagccaattgcgccggctgtgcgcggtggacgtgcattgcatg
ggggcaccccggccgggcgcccagggcgtgcaggtgcaccagcccgacccgcggttgcag
ggcgccaacgcggcgatgacgacgctgtccgccgacctgctgatggccaacgcggcgtcg
gcggccaccgtggtgcattcacacacctggtacaccggcatggccgggcacctggccgcg
ctgctctatgacgtcccgcacgtgttgaccgcgcattcgctcgagccgctgcgcccgtgg
aaggccgaacaactcggcgggggctaccggatctcgacctgggtcgaacacaccgcggcg
ctggccgccgacgcggtcatcgcggtgagctccgcgatgcgcgaggacatcctgcgcgtc
taccccgcgctggatcccggagccgtgcacgtcatccgcaacggcgtcgacaccgacgtg
tggtgcccggcggccccatcgcagggcgagtcgatgctggccgcactgggtgtcgatccg
gaccgtcccctggtggtgttcgtgggccgcatcacccggcagaagggcgtcgcgcacctg
gtggcggccgcccaccggttcagcccggaggcgcaggtgctgctgtgcgccggggcgccc
gacaccccggagatcgccgaggagattcgggatgcggtcgccggcctggcccgcgcacgc
accggcgtcttctggatccgggaaatgcttcccatcggcgagttgcgcgaaatcttatcg
gccgcagcggttttcgtgtgcccgtcggtgtatgagccgttgggcatcgtgaatctggag
gcgatggcctgcggggccgcggtggtggcctcggatgtgggcgggatcccggaggtggtc
gccgacggggtcaccgggactttggtgcattacgaccccggcgatgtggcgggctatcgg
gccggactggccgaggcggtcaacgagctcgtcgccgaccgcggaaaagcgcagcgctac
ggcaaggcaggacgccaacgctgcgtcgaggagttctcgtgggcccacgtcgccgagcag
accctggagatctatcggaaggtgtgtgcgtag

DBGET integrated database retrieval system