KEGG   Mycobacterium sp. MOTT36Y: W7S_10335Help
Entry
W7S_10335         CDS       T02113                                 

Definition
(GenBank) bifunctional RNase H/acid phosphatase
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00860  Porphyrin and chlorophyll metabolism
mmm01100  Metabolic pathways
mmm03030  DNA replication
Module
mmm_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:mmm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    W7S_10335
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    W7S_10335
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmm03032]
    W7S_10335
Enzymes [BR:mmm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     W7S_10335
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     W7S_10335
DNA replication proteins [BR:mmm03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     W7S_10335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H
Motif
Other DBs
NCBI-ProteinID: AFJ35040
UniProt: I2ACL6
Position
2238773..2239912
Genome map
AA seq 379 aa AA seqDB search
MKVVIEADGGSRGNPGPAGYGAVVWTEDRATVLAENKQAIGRATNNVAEYRGLIAGLDDA
LKLGASEAAVYLDSKLLVEQMSGRWKVKHPDLIELHAQARALAARFDRISYSWIPRERNS
HADRLANEAMDAAARANGAAETPEPAEKPEPPGAETAKTVAAPSPTAPGWTGARGTPTRL
LLLRHGQTELSVQRRYSGRGNPALTEVGRRQADAAARYLAQRGGISAVFSSPLQRAYDTA
AAAAKALGLDVTVDDDLIETDFGAWEGLTFAEAAERDPELHRRWLRDTSTAPPGGESFDA
VHDRVSRIRDRVLATQQGTTVLVVSHVTPIKMLLREALDAGPGILYRLHLDLASLSIAEF
YSDGASSVRLVNQTAYLAG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcgtcatcgaagccgacggcggatcacgcggcaaccccggaccggccggctac
ggcgcggtggtgtggaccgaggaccgcgcgaccgtcctcgccgagaacaagcaggccatc
ggccgggccaccaacaacgtcgccgaataccgcggcctgatagccggtttggacgacgcc
ctcaagctcggcgccagcgaggccgcggtgtatctggattccaagctgctggtggaacag
atgtccgggcggtggaaggtcaagcaccccgacctgatcgagctgcatgcccaggcccga
gcgctggcggcgcggttcgacaggatcagctactcgtggattccgcgggagcgcaattcg
cacgccgatcggttggccaacgaggcgatggacgccgcggcccgggccaacggtgcggcg
gagacgcccgagccggccgaaaagcccgagccccccggcgccgagacggcgaaaaccgtt
gcggcaccgtcgccgacggcgccgggctggaccggcgcgcgcggcacccccacccggctg
ctgctgctgcgacacgggcagacggagctgtcggtgcagcgccgctattcggggcgcggc
aacccggcgctcaccgaggtggggcggcggcaggccgacgcggcggcgcggtatctggct
cagcgcggcgggatttcggcggtcttctcctccccactgcagcgggcctacgacaccgcg
gcggcggcggccaaggccctgggcctcgatgtgaccgtcgacgacgacctgatcgagacc
gatttcggggcctgggaggggctgacgttcgccgaggccgccgagcgcgacccggaactg
caccgtcgttggctgcgcgacaccagcaccgccccgccgggcggcgagagcttcgacgcg
gtgcacgaccgggtgtcacggatccgtgaccgcgtcctcgccacccagcaaggcacgacg
gtgctggtggtgtctcacgtgacgccgatcaagatgctgctgcgggaggcgctggacgcc
gggccgggcatcttgtaccggctgcacctcgatctggcgtcgctgagcatcgccgaattc
tattccgacggagcctcttcggtgcgcttggtgaaccagacggcgtacctagccggctga

DBGET integrated database retrieval system