KEGG   Mycobacterium sp. MOTT36Y: W7S_10565Help
Entry
W7S_10565         CDS       T02113                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00020  Citrate cycle (TCA cycle)
mmm00310  Lysine degradation
mmm01100  Metabolic pathways
mmm01110  Biosynthesis of secondary metabolites
mmm01120  Microbial metabolism in diverse environments
mmm01130  Biosynthesis of antibiotics
mmm01200  Carbon metabolism
Module
mmm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    W7S_10565
  Amino acid metabolism
   00310 Lysine degradation
    W7S_10565
Enzymes [BR:mmm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     W7S_10565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H TonB_N Trypan_PARP
Motif
Other DBs
NCBI-ProteinID: AFJ35084
UniProt: I2ACR0
Position
complement(2282083..2283876)
Genome map
AA seq 597 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKIV
AQEDDTVEVGGELAVIGDEDGGSQAPSQQEPQAQSAPPAQPEAQPEPEPQPQAQPEPQPA
QQSSGGGDATPVLMPELGESVTEGTVTRWLKKVGDSVQVDDALVEVSTDKVDTEIPSPVA
GVLISITAEEDATVPVGGELARIGSGSEAAAPAAPQPPPAPKAEPKPEPAPQPQPQPQPQ
PQAQPKPEPTPAPAPQPKAAPEPKAQPAQAQPADASGDGTPYVTPLVRKLAAENNIDLSS
VTGTGVGGRIRKQDVLAAAERKQQADKAPAAAAAPTPAAGEARKAAPAPTPAPALAHLRG
TTQKASRIRQITANKTRESLQATAQLTQTHEVDMTRLVGLRARAKAAFAEREGVNLTFLP
FIARAVIDALKIHPNVNASYNEETKEITYFDAEHLGFAVDTEQGLLSPVVHNAGDLSLAG
LARAIADIAARARSGNLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKR
PRVIVDEFGNESIGVRSICYLPLTYDHRLIDGADAGRFLTTIKHRLEEGAFEADLGL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggtgagagcgtcaccgaggggacggtcacc
cgctggctcaagcaggaaggcgacacggtcgaactcgacgagccgctcgtcgaggtgtcg
accgacaaggtcgacaccgaaatcccgtcgccggccgcgggtgtgctgaccaagatcgtc
gcccaggaagacgacaccgtcgaggtcggcggcgagctggccgtgatcggcgacgaggac
ggcggatcccaggcgccgagccagcaagagccgcaggcgcagtcggcgccccccgcccag
cccgaggcgcaacccgagcccgagccgcagccccaggcccagcccgagccgcagccggcc
cagcagagctccggcggcggcgacgccaccccggtgctgatgcccgaactgggtgagtcg
gtgaccgagggcaccgtgacccgctggctcaagaaggtcggcgattcggtccaggtcgac
gacgcgcttgtcgaggtgtccaccgacaaggtggacaccgagatcccgtcgccggtggcc
ggtgtgctgatcagcatcaccgccgaggaagacgccaccgtgcccgtcggcggcgagctg
gcccgcatcggcagcggttccgaggccgccgcccccgccgcgccgcagccgccgcccgcg
cccaaggccgaacccaagccggaacccgcgccacaaccgcaaccacaaccacagccccag
ccccaggcgcagccgaagcccgaaccgacgccggcccccgcaccgcaaccgaaggcggca
cccgagccgaaagcccaacccgcacaggcccagccggcggacgcgagcggcgacggcacc
ccctacgtgacgccgctggtgcgaaaactggccgccgagaacaacatcgacctcagttcg
gtcaccggcaccggagtgggcggccgcatccgcaagcaagacgtgctggcggccgccgag
cgcaagcagcaggccgacaaggcgcccgccgccgctgctgctcccacccccgctgccggc
gaggcccgcaaggccgctcccgcgcccaccccggcgccggcgctggcgcacctgcgcggc
accacccagaaggccagccggatccgtcagatcaccgccaacaagacgcgcgaatccctg
caggccacagcccaactcacccagacccacgaggtcgacatgaccaggctggtcgggttg
cgggccagggccaaggcggcgttcgccgaacgcgaaggcgtcaacctgaccttcctgccg
ttcatcgcccgcgcggtgatcgacgccctcaagatccacccgaacgtgaacgcgagctac
aacgaggaaaccaaggagatcacctacttcgacgccgagcacctcggcttcgcggtcgac
accgaacagggtctgctctcccccgtcgtgcacaacgccggcgacctgtcgctggccggg
ctggccagggcgatcgccgacatcgccgcgcgcgcccgctcgggcaacctgaaacccgac
gagctctcgggcggcacgttcacgatcaccaacatcggcagccagggggcgctgttcgac
accccgatcctggtcccgccgcaggccgcgatgctgggcaccggcgccatcgtcaaacgc
ccccgggtgatcgtcgacgaattcggcaacgaatcgatcggtgtccgatcgatctgctac
ctgccgctgacctatgaccaccggctgatcgacggcgcggatgccgggcggttcctgacc
accatcaagcaccggctcgaagagggagcgttcgaggccgacctcgggctctga

DBGET integrated database retrieval system