KEGG   Mycobacterium sp. MOTT36Y: W7S_11295Help
Entry
W7S_11295         CDS       T02113                                 

Definition
(GenBank) esterase/lipase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00903  Limonene and pinene degradation
mmm00930  Caprolactam degradation
mmm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmm00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    W7S_11295
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    W7S_11295
Enzymes [BR:mmm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     W7S_11295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 DLH CC2-LZ
Motif
Other DBs
NCBI-ProteinID: AFJ35224
UniProt: I2AD50
Position
2438500..2438739
Genome map
AA seq 79 aa AA seqDB search
MLDADLRSMPPILIQVGGREMLIDDSRHLADRLRSAGSSVEIQVYRGQIHVFQAMFRILP
EARDAIHRAGNFLKASAHR
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgacgcagacctcaggtccatgccaccgatcctgattcaggtaggcggaagagaa
atgttgatcgatgactcgaggcatcttgccgaccgcctccgatcggccggatcaagcgtt
gagatacaggtgtaccggggacagatccacgtgttccaagccatgttccgaatcctgccc
gaggctcgtgacgcgatccaccgcgctggaaacttcctgaaagcttcggcccaccggtga

DBGET integrated database retrieval system