KEGG   Mycobacterium sp. MOTT36Y: W7S_17785Help
Entry
W7S_17785         CDS       T02113                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00900  Terpenoid backbone biosynthesis
mmm01100  Metabolic pathways
mmm01110  Biosynthesis of secondary metabolites
mmm01130  Biosynthesis of antibiotics
Module
mmm_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    W7S_17785
Enzymes [BR:mmm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     W7S_17785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: AFJ36518
UniProt: I2AGU4
Position
complement(3939347..3940594)
Genome map
AA seq 415 aa AA seqDB search
MAPVRAGRHNEWVTNPTTDGQTPGRVRVLVLGSTGSIGTQALDVIAANPDRFEVVGLAAG
GANLDTLLHQRAATGVTNIAVADEAAARRAGDIPFAGPEAVTRLVQETEADVVLNALVGA
LGLRPTLAALESGARLALANKESLIAGGPLVLKAAKPGQIVPVDSEHSALAQCLRGGTPD
EVAKLVLTASGGPFRGWTAAQLEDVTPEQAGAHPTWSMGPMNTLNSASLVNKGLELIETH
LLFGLPYDRIEVVVHPQSIVHSMVTFVDGSTLAQASPPDMRLPIALALGWPRRVPGAAAS
CDFSTASSWEFEPLDNDVFPAVELARHAGQTGGCMTAVYNAANEEAAQAFLAGRIGFGAI
VKTIADVLHAADQWAVSPANVDEVLDAQRWARERAQRVVAQAQPANLSVKASGAV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtggcccccgtccgggccgggcggcacaatgaatgggtgaccaacccgacgaccgacggg
caaaccccgggccgcgtgcgcgtgctggtgctgggcagcaccggctccatcggcacccag
gcgctggacgtcatcgcggccaatccggaccgcttcgaagtggtcggcctggccgcgggt
ggggcgaacctggacacgctgctgcaccagcgcgccgccaccggtgtgaccaacatcgcg
gtcgccgacgaagcggcggcgcggcgggccggcgacatcccctttgccgggcccgaggcc
gtcacccggctggtccaggagaccgaggccgacgtcgtcctcaacgcgctggtgggggcg
ctgggcctgcggcccaccctggccgcgctggagtcgggcgcccggctggcgctggccaac
aaggaatcgctgatcgccggcggtccgctggtgctcaaggccgccaagcccggccagatc
gtgccggtcgactccgaacattccgcgctggcccagtgcctgcgcggcgggactcccgac
gaagtcgccaagctggtgctgaccgcgtccggcggcccgttccgcggctggaccgccgcc
cagctcgaggacgtcacccccgagcaggccggcgcccacccgacgtggtcgatgggcccg
atgaacacgctgaactcggcctcgctggtcaacaaggggctcgagctcatcgagacccac
ctgctgttcggccttccctatgaccgcatcgaggtggtcgtgcacccccagtcgattgtt
cattcgatggtcaccttcgtcgacggctcgaccctcgcccaggccagcccgccggacatg
aggctgccgatcgcgctggccctgggctggccgcgccgggtgcccggcgcggccgcctcc
tgcgacttcagcacggcgtctagctgggaattcgagcccctggacaacgacgtcttcccc
gccgtcgagttggcccggcacgccgggcagaccggcggctgcatgaccgcggtctacaac
gccgccaacgaggaggcggcgcaggcgttcctggcgggccgcatcgggttcggtgccatc
gtcaaaaccatcgccgacgtgctgcacgccgccgaccaatgggccgtctcacccgctaac
gtggatgaggtactcgacgcgcagcgctgggcacgggagcgggcccagcgtgtcgtcgca
caggcgcagcccgccaacttatcggtcaaagcctccggagcggtgtga

DBGET integrated database retrieval system