KEGG   Mycobacterium sp. MOTT36Y: W7S_19840Help
Entry
W7S_19840         CDS       T02113                                 

Definition
(GenBank) phenylacrylic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00130  Ubiquinone and other terpenoid-quinone biosynthesis
mmm00627  Aminobenzoate degradation
mmm01100  Metabolic pathways
mmm01110  Biosynthesis of secondary metabolites
mmm01120  Microbial metabolism in diverse environments
mmm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    W7S_19840
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    W7S_19840
Enzymes [BR:mmm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     W7S_19840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AFJ36921
UniProt: I2AHZ7
Position
complement(4351633..4352289)
Genome map
AA seq 218 aa AA seqDB search
MRLVIAMTGATGAALGIRLLETLGHLGVETHLVLSDWARATIKLETDTSVEAVRALASHA
YSARDLAAGISSGSFRTDGMVVCPCSMKTLSAIRIGFSDNLITRAADVTLKERRRLVLVA
REAPLSEIHLENMHYLARAGAVIFPPTVAYYARPTSVDEVTDYVVGRVLDQLGIEHSLIK
RWKDDQQHPNGDSALTEADRWATRIEQELRQPLCAPIE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagattggtgattgccatgaccggagcgaccggtgccgctctgggcatccgcctactg
gaaaccctcgggcacttgggtgtcgagacgcacctggtgttgagtgactgggcgcgggcg
acgatcaagctcgagaccgataccagcgtcgaggcggttcgggcgttggcctcacacgcg
tacagcgcacgcgacctcgccgccggcatctccagtggatcgttccgcaccgacggcatg
gtggtctgcccgtgcagcatgaagacgttgagcgccatccgaatcggcttcagcgacaac
ctgatcacgcgcgccgccgacgtgacgctcaaggaacgacgcaggctggtcctggtcgcg
cgcgaggccccgttgagtgagatccacttggagaacatgcactacctggcgcgagccgga
gccgtgatcttcccaccgacggtggcgtactacgcgcggcccacctcggtcgacgaagtg
accgattatgtggtcggccgggtccttgatcagctcggcatcgaacacagtctgatcaag
cgctggaaggacgatcagcaacacccaaacggcgactcagctctaacggaggccgaccgg
tgggccacccggatcgagcaggagttgcgccagccgctgtgcgccccgatcgagtga

DBGET integrated database retrieval system