KEGG   Mycobacterium sp. MOTT36Y: W7S_20855Help
Entry
W7S_20855         CDS       T02113                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00020  Citrate cycle (TCA cycle)
mmm00480  Glutathione metabolism
mmm01100  Metabolic pathways
mmm01110  Biosynthesis of secondary metabolites
mmm01120  Microbial metabolism in diverse environments
mmm01130  Biosynthesis of antibiotics
mmm01200  Carbon metabolism
mmm01210  2-Oxocarboxylic acid metabolism
mmm01230  Biosynthesis of amino acids
Module
mmm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    W7S_20855
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    W7S_20855
Enzymes [BR:mmm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     W7S_20855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AFJ37120
UniProt: I2AIJ6
Position
complement(4562206..4563447)
Genome map
AA seq 413 aa AA seqDB search
MSSPGSKEAKIKVKGRVVELDGDEMTRVIWKLIKDQLILPHLDIDLDYYDLGIEHRDRTD
DQVTIDAAYAIKKHGVGVKCATITPDEARVSEFNLKKMWLSPNGTIRNILGGTIFREPIV
ISNVPRLVPGWTKPIVIGRHAFGDQYRATNFKVDKPGTVAITFTPADGSEPMVHEMVSLP
DDGGVVMGMYNFKDSVRDFARASFKYGLNAKWPVYLSTKNTILKAYDGMFKDEFQRIYDE
EFKEQFEAEGLTYEHRLIDDMVAACLKWEGGYVWACKNYDGDVQSDAIAQGYGSLGLMTS
VLMTADGKTVEAEAAHGTVTRHFRQYQAGKPTSTNPIASIFAWTRGLAHRGKLDDTPEVV
EFAQTLENVVVSTVDSGKMTKDLAILIGPDQEWQQSEEFLDSIAENLEKELAS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcccgggttccaaagaagccaagatcaaggtcaagggccgcgtggtcgagctc
gacggcgacgagatgacccgcgtcatctggaagctgatcaaggaccagctgatccttccg
cacctcgacatcgatctggactactacgacctgggcatcgagcaccgtgaccgcaccgac
gaccaggtgacgatcgacgcggcctacgccatcaagaagcacggcgtgggcgtcaagtgc
gcgacgatcacccccgacgaggcccgcgtctccgaattcaacctcaagaagatgtggctg
tcgccgaacgggacgatccggaacatcttgggcggcaccatcttccgcgaaccgatcgtc
atctccaacgtgccacgcctggttccgggctggaccaaaccgatcgtcatcggccgccac
gcgttcggcgaccagtaccgggcgaccaacttcaaggtcgacaagcccggcaccgtcgcc
atcacgttcaccccggccgacggcagcgagccgatggtccacgagatggtgtccctgccc
gacgacggcggcgtggtgatggggatgtacaacttcaaggactccgtgcgcgacttcgcg
cgcgcgtcgttcaagtacggcctgaacgccaagtggccggtgtacctgtccaccaagaac
accatcctcaaggcctacgacggcatgttcaaagacgagttccagcgcatctacgacgag
gaattcaaggagcagttcgaggccgagggcctgacctacgagcaccggctgatcgacgac
atggtcgccgcctgcctcaagtgggagggcggctacgtgtgggcgtgcaagaactacgac
ggcgacgtgcaatccgacgccatcgcccagggctacggctcgctggggctgatgacctcg
gtgctgatgacggccgacggcaagacggtcgaggccgaggccgcgcatggcaccgtcacc
cggcacttccgccagtaccaggccggcaagccgacctcgaccaacccgatcgcctcgatc
ttcgcctggacgcggggactggcgcaccgcggcaagctggacgacacccccgaggtggtc
gagttcgcgcagacgctggaaaacgtcgtcgtctccaccgtcgacagcgggaagatgacc
aaggacctcgccatcctgatcgggcccgaccaggagtggcagcagagcgaggaattcctc
gactcgatcgcggagaacctggaaaaggaactggctagctag

DBGET integrated database retrieval system