KEGG   Mycobacterium sp. MOTT36Y: W7S_22895Help
Entry
W7S_22895         CDS       T02113                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00010  Glycolysis / Gluconeogenesis
mmm00260  Glycine, serine and threonine metabolism
mmm00680  Methane metabolism
mmm01100  Metabolic pathways
mmm01110  Biosynthesis of secondary metabolites
mmm01120  Microbial metabolism in diverse environments
mmm01130  Biosynthesis of antibiotics
mmm01200  Carbon metabolism
mmm01230  Biosynthesis of amino acids
Module
mmm_M00002  Glycolysis, core module involving three-carbon compounds
mmm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    W7S_22895 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    W7S_22895 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    W7S_22895 (gpmA)
Enzymes [BR:mmm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     W7S_22895 (gpmA)
Membrane trafficking [BR:mmm04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    W7S_22895 (gpmA)
Exosome [BR:mmm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   W7S_22895 (gpmA)
  Exosomal proteins of melanoma cells
   W7S_22895 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFJ37528
UniProt: I2AJQ4
Position
complement(4989756..4990505)
Genome map
AA seq 249 aa AA seqDB search
MGDSATLVLLRHGESEWNSLNLFTGWVDVGLTDKGRTEAVRSGELLAEHNLLPDVLYTSL
LRRAISTAHLALDAADRLWIPVRRTWRLNERHYGALQGLDKAETKARYGDDQFMAWRRSY
DTPPPPIEMGSTYSQDTDPRYADIGGGPLTECLADVVVRFLPYFTDVIIPDLRSGKTVLI
VAHGNSLRALVKHLDRMSDDDIVGLNIPTGIPLRYDLDADLRPVVPGGTYLDPEAAAAGA
AAVAGQGRR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggtgactccgccacgctggtcctgctccgtcacggtgaaagcgaatggaattcgctg
aacctgttcaccggttgggtggacgtcgggctgaccgacaagggccgcaccgaggcggtg
cgcagcggcgagctgctggccgaacacaatctgttgcccgacgtcctctacacgtcgctg
ctgcgccgggccatctccaccgcgcacctggcactggacgccgccgaccggctgtggatc
ccggtgcggcgcacctggcggctcaacgaacgccattacggggcgctgcagggcctggac
aaggccgagaccaaggcgcgctacggcgacgaccagttcatggcctggcgacgcagctac
gacacgccgcccccgccgatcgagatgggcagcacctacagccaggacaccgatccccgc
tacgccgacatcggcggcgggccgctgaccgagtgccttgccgacgtggtcgtccgcttc
ctgccgtatttcaccgacgtcatcatcccggacctgcgcagcggcaagacggtgctgatc
gtcgcgcacggcaactcgctgcgggccctggtcaagcacctcgatcggatgtccgacgac
gacatcgtgggcctgaacatcccgaccggcatcccgctgcgctacgacctggacgccgac
ctgcgcccggtggtgcccggcggcacctatctggaccccgaggcggccgccgccggtgcc
gccgcggtcgccggccagggccgccgctga

DBGET integrated database retrieval system