KEGG   Mycobacterium sp. MOTT36Y: W7S_22995Help
Entry
W7S_22995         CDS       T02113                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00630  Glyoxylate and dicarboxylate metabolism
mmm01100  Metabolic pathways
mmm01110  Biosynthesis of secondary metabolites
mmm01120  Microbial metabolism in diverse environments
mmm01200  Carbon metabolism
Module
mmm_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    W7S_22995
Enzymes [BR:mmm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     W7S_22995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AFJ37548
UniProt: I2AJS4
Position
complement(5007951..5009237)
Genome map
AA seq 428 aa AA seqDB search
MSVVGTPKSAEQIQKDWDTNPRWKDVTRTYSAKDVVALQGTVVEEATLARRGAEVLWEQL
HDLEYINALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
VRRINNALLRADEIAKVEGDTSVKNWLAPIVADGEAGFGGALNVYELQKAMIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVCDVPTVVIARTDAEAATLITSD
VDERDQPFITGERTKEGFYRVRNGLEPCIARAKAYAPYSDLIWMETGTPDLELAAKFAEG
VKSEFPDQMLAYNCSPSFNWKKHLDDSTIAKFQKELGAMGFKFQFITLAGFHALNYSMFD
LAYGYARNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPSSSTTALTG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgttggcacccccaagagcgccgaacagattcagaaggactgggacaccaac
ccgcggtggaaggacgtcacccgcacctacagcgccaaggacgtcgtcgccctgcagggc
accgtcgtcgaggaggccaccctggcccgccgcggcgccgaggtgctgtgggagcagctc
cacgacctcgagtacatcaacgcgctcggcgcgctgaccgggaacatggccgtccagcag
gtgcgcgccggcctcaaggccatctacctgtccgggtggcaggtcgccggggacgcgaac
ctgtccgggcacacctaccccgaccagagcctctacccggccaactcggtgccccaggtg
gtccgccggatcaacaacgcgctgctgcgcgccgacgagatcgccaaggtcgagggcgac
acctcggtgaagaactggctggcccccatcgtcgccgacggtgaggccggtttcggtggc
gcgctcaacgtctacgagctgcagaaggccatgatcgcggccggtgtggcgggctcgcac
tgggaggaccagctggcttcggagaagaagtgtggtcacctgggcggcaaggtgctgatc
ccgacccagcagcacatccgcaccctgacctcggcccggctggcggccgacgtttgcgac
gtgccgaccgtcgtcatcgcccggaccgacgccgaggcggccaccctgatcacctcggac
gtcgacgagcgtgaccagccgttcatcaccggtgagcgcaccaaggagggcttctaccgg
gtccgcaacggcctggagccctgcatcgcccgggccaaggcgtacgcgccgtactccgac
ctgatctggatggagaccggcactccggacctcgagctcgccgcgaagttcgccgagggc
gtcaagtccgagttccccgaccagatgctggcctacaactgctcgccgtcgttcaactgg
aagaagcaccttgacgactccaccatcgcgaagttccaaaaggagcttggcgcaatggga
ttcaagttccagttcatcacgctggccggcttccacgccctgaactactcgatgttcgac
ctggcctacggctacgcccgcaaccagatgagcgcctacgtcgagctgcaggagcgcgag
ttcgccgccgaggagcgtggctacaccgccaccaagcaccagcgtgaggtgggtgccggt
tacttcgaccgcatcgccaccacggtcgacccgagctcgtcgaccaccgcgctgaccggc
tccaccgaagaggggcagtttcactga

DBGET integrated database retrieval system