KEGG   Candidatus Midichloria mitochondrii: midi_00690Help
Entry
midi_00690        CDS       T01561                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
mmn00020  Citrate cycle (TCA cycle)
mmn00310  Lysine degradation
mmn01100  Metabolic pathways
mmn01110  Biosynthesis of secondary metabolites
mmn01120  Microbial metabolism in diverse environments
mmn01130  Biosynthesis of antibiotics
mmn01200  Carbon metabolism
Module
mmn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    midi_00690 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    midi_00690 (sucB)
Enzymes [BR:mmn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     midi_00690 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh SAPS
Motif
Other DBs
NCBI-ProteinID: AEI88987
UniProt: F7XWD8
Position
653572..654249
Genome map
AA seq 225 aa AA seqDB search
MSRLRKTIAARLKDSQNTAAILTTFNEVNMSAIIQARQTYQEKFQKKHGIKLGFMSFFVK
AVIQALKEIPAVNAEINGDDIIYKNYYDIGVAVGTENGLVVPVVRDADSLSFAEIEKTIA
NLGQKAKESKLSIADMSGGTFSITNGGIYGSMLSTPIINPPQSAILGMHNIVERPYVVKG
QIVVRPIMYIALSYDHRIIDGKEAVTFLFRIKEMIETPERLLFDI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagtagactaagaaaaactattgctgcaagattaaaagattctcaaaataccgctgct
attttaactacttttaacgaagttaatatgtcagcgattatacaagcgcgtcaaacttat
caggaaaaattccaaaaaaagcatggcataaaattggggtttatgtccttttttgtaaaa
gctgtaatccaggcattgaaagaaatccctgcggttaatgcagaaattaacggcgatgat
attatatataaaaattactatgatattggagtggccgttggcaccgaaaatggtctagtg
gtacccgttgtgagagatgcggattccttatcctttgccgagatagaaaaaactatcgct
aatttggggcaaaaagctaaagaaagtaaattgagtatagccgatatgagcggcggtaca
tttagtattactaatggtggtatctatggctccatgctttcaacaccaataattaatcca
cctcagtcagcaattcttggtatgcacaatatcgttgaacgtccttatgttgttaaaggt
caaatagttgttcgccctataatgtatattgctctttcatatgatcaccgaatcattgat
ggcaaagaagcagtaacattcttattccgaatcaaagagatgatagaaactcctgagagg
ttattatttgatatttag

DBGET integrated database retrieval system