KEGG   Mycoplasma mobile: MMOB0930Help
Entry
MMOB0930          CDS       T00176                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mmo  Mycoplasma mobile
Pathway
mmo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MMOB0930 (recD)
Enzymes [BR:mmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MMOB0930 (recD)
DNA repair and recombination proteins [BR:mmo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MMOB0930 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Viral_helicase1 UvrD_C_2 AAA_11 AAA AAA_22 DUF2075 HHH_4 AAA_18 SMC_N AAA_14 PPARgamma_N MPS-4 RsgA_GTPase T2SSE AAA_12 Ribosomal_S13
Motif
Other DBs
NCBI-ProteinID: AAT27579
UniProt: Q6KIJ7
Position
120929..123133
Genome map
AA seq 734 aa AA seqDB search
MNKNTSFKIKAKIKNVIWKNPNNLGIKIVNLAILEDEFNYLKEKEFPAKDYKSMLVEELE
YELDVSFSDDSKKTLYINNASITFPNTAKKLINFFSSSLFPGIGKTSATLIVEKLKIDSI
EKIVDHIEDISILIGQSKAKVIQEVIENNYNNYEAHQFFIINSLPISLLEKFSFYYGKKN
LLNKLKENLYKIVYFDPSVKLELLTKIHKLLNLKIDELEFLKASIYKILFLYTNNSNNTY
MSLDFLFKSFSEKFSYISLDKVKFSDLITFLKNEKHLDFFKIKNKIFVISEFFKDHEKFI
FEYISSLEKKISQHTFNLEKIINSKTLDSIQKEAIIYSLNNSFNIISGIPGSGKSAIIKR
IYKKAKEIYKDEEIHVLTPTGKATIILKQNNQEAKTIHSFLKWNKDNNQFDFKTINYDHV
KVIIIDEFSMVDTYVFSTLLKVVPNLEKLILVGDYNQLPSIKGGQILKDLIESNLFKVFF
LKTNYRQKDKFDIMKNALMVNDDLIPTFNSENTLFLEASSENYFNKLTTYLDLFIEKHHN
YTFFETMNLINILSVKYEGYGGINEINQSLQNYFQRHYFKDNQPFYKTPNLKLFINDKVI
QIENDPENDVYNGELGFINNVKLKENKEIDLISVDFGNKIITYNLNNFLQSVKLAYAISV
HKFQGSASEILIFLIFKNQKKLLSKKLIYTAFSRAKSFLIVIGEHEAFSISVAKENNLDR
KTYLRYLLNFNKMK
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaatacttcttttaaaataaaagcaaaaattaaaaatgttatttggaaaaat
ccaaataatttaggcataaaaattgttaatttagcaattcttgaagacgaatttaattat
ttgaaagaaaaagaattcccagctaaagattataaatctatgttagttgaagaattagaa
tatgaattagatgtaagttttagtgatgattctaaaaaaacactttatattaacaatgca
tcaataacgtttccaaatacagcaaaaaaattgataaattttttttcatcttctctattt
ccaggtatcggaaaaacctcagcaactttaattgttgaaaaattaaaaattgattctata
gaaaaaatagtggatcatattgaagacatttcaattttaattgggcaatcaaaagctaaa
gtaattcaagaagtaattgaaaataattataataattatgaagctcatcaattttttata
attaattctttacccatttctttgttagaaaaatttagcttttattatggcaagaaaaat
ctattaaataaattaaaagaaaatttatataagattgtttattttgatccctctgtaaaa
ttagaacttttaacaaaaattcacaaacttttaaatttgaaaattgatgaattagaattt
ttaaaagctagtatttacaaaattcttttcctttataccaataattcaaataacacctac
atgagtttagattttttgttcaaatctttttctgaaaaatttagttatattagcctagat
aaagttaaattttctgatttaataacttttttaaaaaatgaaaagcatctagattttttt
aaaataaaaaataaaatttttgttattagtgaatttttcaaagatcacgaaaaatttatt
tttgaatacattagtagtcttgaaaaaaaaattagtcagcacacttttaatttagaaaaa
attatcaattctaaaactttagattcaattcaaaaagaagcaataatttattctttaaat
aactcttttaatattattagtggaattccaggtagtggtaaaagcgcaattattaaaaga
atttataaaaaagcaaaggaaatttataaagatgaagaaattcatgttttaactccaaca
ggtaaggcaacaataattttaaaacaaaataatcaagaagcaaaaaccattcacagtttt
ttaaaatgaaacaaagataataatcaatttgattttaaaactataaattatgatcatgtt
aaagtaattattattgatgaatttagtatggtagatacatatgtttttagcactttatta
aaagtagttcctaatttagaaaaattaatacttgtaggtgattacaatcagctaccttct
attaaaggtggtcaaattttaaaagatttaattgaatctaatctttttaaagtctttttt
ttaaaaaccaattatcgtcaaaaagataaatttgatattatgaaaaatgctttaatggtt
aatgatgatttgattcctacatttaattcagaaaatactttatttctagaagcttcttca
gaaaattattttaataaattaacaacttatcttgatctttttattgaaaaacatcataat
tacactttttttgaaactatgaatttaataaatatattaagcgttaaatatgaaggatat
ggaggcattaacgaaattaatcaaagtcttcagaattattttcaaagacattattttaaa
gataatcaacctttttataaaactccaaatttaaaattattcataaatgataaggtgatt
caaattgaaaatgatcctgaaaacgatgtctataatggtgaacttggttttattaataat
gttaaattgaaagaaaataaagaaattgatttaattagtgttgattttggaaataaaata
ataacttacaatttgaataattttttgcaatcagtaaaattagcttatgcaataagtgtt
cataaatttcaaggctctgcttcagaaattttaatttttttaatatttaaaaatcagaaa
aaattattatctaaaaaacttatttatacagcttttagtagagcaaaatcttttttaata
gtaattggtgaacacgaagcttttagtataagtgttgcaaaagaaaataatttagataga
aaaacctatttaagatatttactaaatttcaataaaatgaaataa

DBGET integrated database retrieval system