KEGG   Mycoplasma mobile: MMOB2050Help
Entry
MMOB2050          CDS       T00176                                 

Gene name
glpQ
Definition
(GenBank) glycerophosphoryl diester phosphodiesterase
  KO
K01126  glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
mmo  Mycoplasma mobile
Pathway
mmo00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mmo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MMOB2050 (glpQ)
Enzymes [BR:mmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     MMOB2050 (glpQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDPD
Motif
Other DBs
NCBI-ProteinID: AAT27691
UniProt: Q6KI85
Position
274755..275465
Genome map
AA seq 236 aa AA seqDB search
MNEKLILAHRGFSSISPENTKLSFDLAYLFGFDGVELDVHLTKDKKLVIIHDENTIRTSK
INSIISKSNLIDLEKQDMGAFWKLKLPNQKILTLEEFLHLYIDKFKIINIEIKTDVEHYV
DIEKIIYQVILPFKDKWDKLVFSSFNFESLEILNQMDKNIQLAFLWWTKGQFNKIDPEKF
KFIKYFNPWIEIYFKDIEKYDSFSKKYMFWTIKSSKSFKKFQKMEKAFCLISNYLY
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaaactaattttagctcatagaggattttcttctattagcccagaaaataca
aagttaagctttgatttagcatatctttttggatttgatggtgttgaactagatgttcat
ttaacaaaagataaaaaacttgtgattatccatgatgaaaatacaattagaacatctaaa
ataaattctataatcagtaaatctaatttaattgacttagaaaaacaagatatgggggct
ttttgaaaattaaaattacccaatcaaaaaattttaactttagaagagtttttacatctt
tatatagacaaatttaaaataattaatattgaaataaaaacagatgtagaacattatgtt
gatattgaaaaaattatttatcaagttattttaccttttaaagataaatgagataaatta
gtatttagttcttttaattttgaatctttagaaattttgaatcaaatggataaaaatatt
caacttgcttttctttgatggacaaaaggacaatttaataaaatagatccagaaaaattt
aaatttataaagtatttcaatccatgaatagaaatttattttaaagatatagaaaaatat
gattctttttctaaaaaatatatgttttgaacaataaaaagttccaaatcttttaaaaaa
tttcaaaaaatggaaaaagctttttgcctaatttctaattacttatattaa

DBGET integrated database retrieval system