KEGG   Mycoplasma mobile: MMOB2170Help
Entry
MMOB2170          CDS       T00176                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAT27703
UniProt: Q6KI73
Position
284601..284948
Genome map
AA seq 115 aa AA seqDB search
MNTIKTKQFSEEIIKIQTIPFKDRKKIISNLCLFYKSNKLKSNLKNEELEKTEYENISLF
EKILLLLTKEQRYFIKKSFLEDEKFHWSKSYYSKSTFYKKLHDSINNFLFLIYVN
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaattaaaactaagcaattttctgaagaaataataaaaattcaaactattcca
tttaaagatcgaaaaaaaataatttcaaatctttgtttgttttataaaagtaataaattg
aagtccaatttaaaaaatgaagaacttgaaaaaacagaatatgaaaatatttcattattt
gaaaaaattcttttactacttactaaagagcaaagatattttataaaaaaatctttttta
gaagatgaaaaatttcattgatctaaaagttattactcaaaatctacattctacaaaaaa
ttgcatgactcaataaacaattttctatttttgatatatgttaattaa

DBGET integrated database retrieval system