KEGG   Mycoplasma mobile: MMOB2260Help
Entry
MMOB2260          CDS       T00176                                 

Gene name
ssb
Definition
(GenBank) single strand binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
mmo  Mycoplasma mobile
Pathway
mmo03030  DNA replication
mmo03430  Mismatch repair
mmo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MMOB2260 (ssb)
   03430 Mismatch repair
    MMOB2260 (ssb)
   03440 Homologous recombination
    MMOB2260 (ssb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmo03032]
    MMOB2260 (ssb)
   03400 DNA repair and recombination proteins [BR:mmo03400]
    MMOB2260 (ssb)
   03029 Mitochondrial biogenesis [BR:mmo03029]
    MMOB2260 (ssb)
DNA replication proteins [BR:mmo03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    MMOB2260 (ssb)
DNA repair and recombination proteins [BR:mmo03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Other MMR factors
     MMOB2260 (ssb)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    MMOB2260 (ssb)
Mitochondrial biogenesis [BR:mmo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    MMOB2260 (ssb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSB DUF4667 tRNA_anti-codon
Motif
Other DBs
NCBI-ProteinID: AAT27712
UniProt: Q6KI64
Position
complement(293169..293696)
Genome map
AA seq 175 aa AA seqDB search
MKESYMNKVLLVGRIAQKGELKETSNSNIPYVRFRVAVRKDNVSQNAREDSDFIPVIAWR
NTATFVNNYMNIGDLVSVEGTFSTSTFKNSNDEFVNVYEVTISNIKSLESKKARDERKEF
QGTNNFETKQKSNSNFSEPTFVDSSENKSSKIQKTSQSFKTETDEDEEMDWDLEF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagtcttatatgaataaagtattattagttggaagaattgctcaaaaaggagaa
ttaaaagaaacatctaattcaaatattccatatgttagatttcgtgttgctgtaagaaaa
gacaatgtaagtcaaaacgcaagagaagatagtgattttattccggtgattgcttgaaga
aacactgctacttttgtaaataattacatgaacataggagatttagtaagtgttgaagga
acttttagcacatctacattcaaaaattcaaatgatgaatttgtaaatgtttatgaagtt
actatttcaaatataaaatctttagaaagtaaaaaagctagagatgaaagaaaagagttt
caaggaacaaataactttgaaacaaaacaaaaatccaattcaaatttttcagaaccaaca
tttgttgattcgagcgaaaataaaagttcaaaaattcaaaaaacaagtcaaagtttcaaa
actgaaactgatgaagatgaagaaatggattgagatttagaattttag

DBGET integrated database retrieval system