KEGG   Mycoplasma mobile: MMOB2270Help
Entry
MMOB2270          CDS       T00176                                 

Gene name
rpsF
Definition
(GenBank) 30S ribosomal protein s6
  KO
K02990  small subunit ribosomal protein S6
Organism
mmo  Mycoplasma mobile
Pathway
mmo03010  Ribosome
Module
mmo_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    MMOB2270 (rpsF)
Ribosome [BR:mmo03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    MMOB2270 (rpsF)
  Bacteria
    MMOB2270 (rpsF)
Mitochondrial biogenesis [BR:mmo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MMOB2270 (rpsF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S6
Motif
Other DBs
NCBI-ProteinID: AAT27713
UniProt: Q6KI63
Position
complement(293718..294182)
Genome map
AA seq 154 aa AA seqDB search
MPNKYEILIMTDPKEEKSVIEKFTNQIFKKIEKFEQLERTELAYKVNHSSTAHYFLVNVE
AKGPEITEFNRRANISKTIWRTMVINLDTEKYLSKKASEKKFTKKITADRPRRNPSTINR
ENVGTENKEFSNNRESSGEKRIYTRKKVQSENRE
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcctaataaatatgaaattttaattatgactgatccaaaagaagaaaagtcagtaatt
gaaaaattcacaaatcaaattttcaaaaaaattgaaaaatttgaacaacttgaaagaaca
gaattagcttataaagttaatcattcaagtacagcgcactattttttagtaaatgttgaa
gcaaaaggacctgaaattactgaatttaatagacgtgcaaatatttcaaaaactatttga
cgtactatggttattaacttagacacagaaaaatatttaagcaaaaaagctagtgaaaag
aaatttactaaaaaaataacagcagatagacctagaagaaatccaagtacaattaacaga
gaaaatgttggaacagaaaataaagaattttcaaataatagagagtcttcaggggaaaaa
agaatctatacaagaaaaaaagttcaatctgaaaatagagaataa

DBGET integrated database retrieval system