KEGG   Mycoplasma mobile: MMOB2300Help
Entry
MMOB2300          CDS       T00176                                 

Gene name
rpsI
Definition
(GenBank) 30S ribosomal protein s9
  KO
K02996  small subunit ribosomal protein S9
Organism
mmo  Mycoplasma mobile
Pathway
mmo03010  Ribosome
Module
mmo_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mmo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MMOB2300 (rpsI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmo03011]
    MMOB2300 (rpsI)
Ribosome [BR:mmo03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    MMOB2300 (rpsI)
  Bacteria
    MMOB2300 (rpsI)
  Archaea
    MMOB2300 (rpsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S9
Motif
Other DBs
NCBI-ProteinID: AAT27716
UniProt: Q6KI60
Position
295628..296020
Genome map
AA seq 130 aa AA seqDB search
MSDIMYRGLGRRKSSSARVILRPGKGEFLINKRVARDYLMSDILLKDALQPIVISDQKEK
FDITVNVRGGGLSGQAGAIRLGIARALLEVSVDFRKNLKTAGMLTRDARVKERKKPGLKK
ARKARQFSKR
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatataatgtaccgtggattaggaagaagaaaaagttcttctgcgagagtaatt
ttgagaccaggtaaaggtgaattcttaattaacaaaagagtagctagagattacctgatg
tctgatatcttattgaaagatgctctacaaccaattgttatttcagatcaaaaagaaaaa
tttgatattactgttaatgtaagaggtggaggtttgagtggtcaagcaggagctattaga
ttaggaattgcaagagctttattagaagtttcagttgattttcgtaaaaacttaaaaaca
gcaggaatgttaacaagagatgctagagttaaagaacgtaaaaaaccaggattgaaaaaa
gctagaaaagcaagacaattttcaaaacgttaa

DBGET integrated database retrieval system