KEGG   Mycoplasma mobile: MMOB2310Help
Entry
MMOB2310          CDS       T00176                                 

Definition
(GenBank) O-methyltransferase putative nucleic acid modification enzyme
  KO
K15460  tRNA1Val (adenine37-N6)-methyltransferase [EC:2.1.1.223]
Organism
mmo  Mycoplasma mobile
Brite
Enzymes [BR:mmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.223  tRNA1Val (adenine37-N6)-methyltransferase
     MMOB2310
Transfer RNA biogenesis [BR:mmo03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    MMOB2310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS N6_Mtase Methyltransf_10 Methyltransf_23 PrmA UPF0020 Methyltransf_18 Methyltransf_12 Methyltransf_25 Cons_hypoth95 Methyltransf_15 Methyltransf_5
Motif
Other DBs
NCBI-ProteinID: AAT27717
UniProt: Q6KI59
Position
296216..296989
Genome map
AA seq 257 aa AA seqDB search
MILKVKKTWEKNSLGFDSNLFIYQDKTMFNYSVDTILLGNFCSINSKTKSILEIGTNNAA
LAIFVSERNKNIKIDAIELQKKAIHLANFNVIMNSKEEQISIIHANFNSFWKKHNKNQAK
KYDSIICNPPFYQIGKRQLKNVSKEKLIATYDLKLNFDQLIKGASKIIKQKGYFSVVIPT
ERSIDFFTILRKYDFEPKKVQFIHPRINQKSNLVLIESRYKTGWGTNFLENIYLHPEDEQ
NHEYLPNVKSLYKPIKF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgatactaaaagtaaagaaaacttgagagaaaaactctttgggatttgattcaaattta
tttatttatcaagataaaacaatgtttaattattctgtagacacaattttattgggtaat
ttttgttctataaattccaaaactaaaagtattcttgaaataggaacaaataatgcagct
cttgcaatttttgtttctgagagaaataagaatattaaaattgatgcaattgaattgcaa
aaaaaagcgattcatttagctaattttaatgttattatgaattcaaaagaagaacaaatc
tcaattattcatgctaattttaattctttttgaaaaaaacataataaaaatcaagcaaaa
aaatatgattcaatcatttgtaatcctccattttatcaaattggtaaaagacaattaaaa
aatgtaagtaaagaaaaactaattgcaacttatgatcttaaactcaattttgatcaatta
ataaaaggagcttctaaaattattaaacaaaaaggatatttttcggttgtaataccaact
gagagatcaattgatttttttacaattttaagaaaatatgatttcgaaccaaaaaaagtt
caatttatccaccctagaattaatcaaaaatcaaatttagttttaattgaatcaagatat
aaaacaggttgaggaacaaattttttagaaaatatttatttacaccctgaagatgaacaa
aatcatgaatatttacctaatgttaaaagtttatataaaccaattaaattttag

DBGET integrated database retrieval system