KEGG   Mycoplasma mobile: MMOB2490Help
Entry
MMOB2490          CDS       T00176                                 

Gene name
rpsH
Definition
(GenBank) 30S ribosomal protein s8
  KO
K02994  small subunit ribosomal protein S8
Organism
mmo  Mycoplasma mobile
Pathway
mmo03010  Ribosome
Module
mmo_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mmo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MMOB2490 (rpsH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmo03011]
    MMOB2490 (rpsH)
Ribosome [BR:mmo03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    MMOB2490 (rpsH)
  Archaea
    MMOB2490 (rpsH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S8
Motif
Other DBs
NCBI-ProteinID: AAT27735
UniProt: Q6KI41
Position
305433..305834
Genome map
AA seq 133 aa AA seqDB search
MSRVITDPIADMLVRIKNATARKHKNVLIPFSNKKSKILEIIKDQGYIFDFAIEGDSVKK
NLNVTLKYKNNISVITGVKRISKPGLKVYSSVEDLPMVLNGYGIAIISTSKGVLTDKQAR
KENVGGEIVAYIW
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtctagagttattacagatccaattgcagatatgttagtaagaataaaaaatgcaact
gcaagaaaacataaaaatgttttaatccctttttcaaataaaaaatctaaaattttagaa
atcattaaagatcaaggatatatttttgattttgctattgaaggagatagtgttaagaaa
aatcttaatgttactttaaaatacaaaaataatatcagtgtaattactggtgtaaaaaga
atttcaaaacctggactaaaagtttattcttcagttgaagatttaccaatggtattaaat
ggttatggaattgcaatcatttctacttcaaaaggtgttttaaccgacaaacaagcaaga
aaggaaaatgtaggtggcgaaatcgttgcttacatttgataa

DBGET integrated database retrieval system