KEGG   Mycoplasma mobile: MMOB2510Help
Entry
MMOB2510          CDS       T00176                                 

Gene name
rplR
Definition
(GenBank) 50S ribosomal protein l18
  KO
K02881  large subunit ribosomal protein L18
Organism
mmo  Mycoplasma mobile
Pathway
mmo03010  Ribosome
Module
mmo_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mmo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MMOB2510 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmo03011]
    MMOB2510 (rplR)
Ribosome [BR:mmo03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    MMOB2510 (rplR)
  Bacteria
    MMOB2510 (rplR)
  Archaea
    MMOB2510 (rplR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID: AAT27737
UniProt: Q6KI39
Position
306379..306732
Genome map
AA seq 117 aa AA seqDB search
MAKLLSRNDARKAKHLRIRNKIRKTTNLPRVFVYKSLQNFYAQLFDDKLNKTIVSLGTSK
NKEYSGNIAAAKKLGHEMGALLKTKKIDKIVFDRSGYIYHGRVKAFAEAMREEGVKF
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactattaagtcgtaatgatgcaagaaaagcaaaacatctacgtattcgtaat
aaaatacgtaaaacaacaaatttacctcgtgtttttgtttacaaatctttacaaaatttt
tatgcacaactttttgatgataaattaaataaaacaattgttagtttaggaacatctaaa
aacaaagaatatagcggtaatatagctgctgctaaaaaactaggacatgaaatgggagct
ttattaaaaactaaaaaaattgataaaattgtttttgatcgttctggatatatttatcac
ggaagagtaaaagcctttgctgaagcaatgcgtgaagaaggagttaaattttaa

DBGET integrated database retrieval system