KEGG   Mycoplasma mobile: MMOB2540Help
Entry
MMOB2540          CDS       T00176                                 

Gene name
secY
Definition
(GenBank) preprotein translocase secY subunit
  KO
K03076  preprotein translocase subunit SecY
Organism
mmo  Mycoplasma mobile
Pathway
mmo02024  Quorum sensing
mmo03060  Protein export
mmo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    MMOB2540 (secY)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    MMOB2540 (secY)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    MMOB2540 (secY)
Secretion system [BR:mmo02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   MMOB2540 (secY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecY
Motif
Other DBs
NCBI-ProteinID: AAT27740
UniProt: Q6KI36
Position
307915..309333
Genome map
AA seq 472 aa AA seqDB search
MIPKIKDFFANIPTSIAKYFFILRNAWKDFRKKRALLNKIVFTIFLLSIFAIAGSITLPG
VSVGNLDSNTFLGILNLVGGGGLRNFSIVALGISPFITASLVMQILQTKLFPPIYRLSQS
GPIGRRKINIITRAITIFLGVVQSMTIVSALSAQNSFISLTNEFNVFWYQFIILPVILIA
GTVFSIFIGDQITDKGVGNGTTLLIFTGIVITLPTQFTATFNALVGEQQRVSSLSNGIVT
FISYVFGFIILMYIIGFVYNAERRIPIQQVGAGRAKNEKELSYLPIKINPGGISPIIFAL
IIISFPQLFASVFPISNPFRIWVESNLRPNNTIGFILFISITFIFAIFFGLQQSKVDKIA
EDFAKNSTFIPGIKPGQETETYLTGIVLRLCFFSAFYLIIIGGMQFAQQLAGVPENISFG
GTSVIILVTASYETITQIQARKKSQSLSQKHKKILEVTSKNNNDEKSKGLLW
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgatccctaaaataaaagatttttttgctaatattccaacaagtattgcaaaatatttt
tttattctaagaaatgcctgaaaagattttagaaaaaaaagagcattattaaataaaatt
gttttcacaatttttcttttatctatttttgcaattgcaggatcaataacactgcctggt
gtaagtgttggtaatttagactcaaacacttttttaggaattttaaatcttgtaggtggt
ggaggattaagaaactttagtattgtagctttaggaatcagtccttttattactgcttct
cttgttatgcaaattttgcaaaccaaactatttccacctatttataggcttagtcaaagc
ggacctattggaagaagaaaaattaatattatcacaagagcaattacgatttttttagga
gttgttcaatcaatgacgattgtttcagcactttccgctcaaaattcttttatatcatta
acaaatgaatttaatgttttttgatatcagtttataattttaccagttattttaattgca
ggaacagtttttagtatttttattggtgatcaaattactgataaaggtgttggaaatgga
acaacattgttgatttttacagggattgtaataacattacctactcaatttacagcaact
ttcaatgctcttgtaggtgaacaacaaagagtctcttctttatcaaatgggatcgtaact
tttatttcttatgtttttggttttattatcttaatgtacattataggatttgtttataat
gccgaaagaagaattccaattcaacaagttggagctggtagagctaaaaatgaaaaagaa
ctttcttatttaccaattaaaattaatccaggtggaatcagtccaatcatttttgctttg
ataataatttcttttccacaattatttgcaagcgtctttcctatttcaaatccttttaga
atttgagtagaaagtaatttaaggccaaataatacaattgggtttattttgtttatttca
ataactttcatttttgcaattttctttggattgcaacaatctaaagttgataaaattgct
gaagattttgctaaaaactcaacttttatccctggtataaaaccaggacaagaaacagaa
acttatttgacaggaattgttttaagattatgtttttttagtgctttttacttaatcata
attggaggaatgcaatttgctcagcaattagcaggagttcctgaaaatattagtttcggt
gggacaagtgtcattattttagtaactgcttcatatgaaacaattactcaaattcaagca
agaaaaaaaagtcaaagcttaagtcaaaaacataaaaaaatacttgaagttacttcaaag
aataataatgatgaaaaatcaaaaggattattatgataa

DBGET integrated database retrieval system