KEGG   Mycoplasma mobile: MMOB2590Help
Entry
MMOB2590          CDS       T00176                                 

Gene name
rpsM
Definition
(GenBank) 30S ribosomal protein s13
  KO
K02952  small subunit ribosomal protein S13
Organism
mmo  Mycoplasma mobile
Pathway
mmo03010  Ribosome
Module
mmo_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    MMOB2590 (rpsM)
Ribosome [BR:mmo03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    MMOB2590 (rpsM)
  Archaea
    MMOB2590 (rpsM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S13 FbpA IMS_HHH
Motif
Other DBs
NCBI-ProteinID: AAT27745
UniProt: Q6KI31
Position
311071..311439
Genome map
AA seq 122 aa AA seqDB search
MARILNVEIPNNKRVIISLTYVYGIGRSLSKQILAEANIDENIRVKDLSEEDLTKIRNIA
SRFTTEGDLRREIQLNIKRLMEIKSYRGIRHRKGLPVRGQVTQKNARTRKGPRKTVAGKK
GK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtattttaaatgtcgaaattcctaataataaaagagtaatcatctctttaact
tatgtatacggaattggtagatcattatctaaacaaattttagcagaagctaatattgat
gaaaatattagagtaaaagatctatcagaagaagacttaacaaaaattagaaatattgct
tctagattcacaacagaaggtgatttaagaagagaaattcaactaaacattaagcgtttg
atggaaatcaaatcttatagaggtattagacaccgtaaaggtcttccagtaagaggtcaa
gtaacacaaaaaaatgcaagaactagaaaaggtcctcgtaaaactgttgctggtaagaaa
ggtaaataa

DBGET integrated database retrieval system