KEGG   Mycoplasma mobile: MMOB2620Help
Entry
MMOB2620          CDS       T00176                                 

Gene name
rplQ
Definition
(GenBank) 50S ribosomal protein l17
  KO
K02879  large subunit ribosomal protein L17
Organism
mmo  Mycoplasma mobile
Pathway
mmo03010  Ribosome
Module
mmo_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    MMOB2620 (rplQ)
Ribosome [BR:mmo03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    MMOB2620 (rplQ)
  Bacteria
    MMOB2620 (rplQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L17 NPIP Carla_C4
Motif
Other DBs
NCBI-ProteinID: AAT27748
UniProt: Q6KI28
Position
312849..313211
Genome map
AA seq 120 aa AA seqDB search
MANPVQLFRRNSSWQKGVIRSLATDIIIHGRITTTEARAKILRSYVDKLITQAKTDTLAS
RRRAASFLRNIQLKDGKTSLQYLFASVGPKYKDRNGGYTRIIKLPNRQGDNSKMSIIELV
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggccaatccagtacaattatttagacgtaatagttcttgacaaaaaggtgttattcgt
tctcttgcaactgatattattattcatggaagaattacaacaacagaagcaagagcaaaa
attttaagatcatatgttgataaattaattactcaagcaaaaacagatacattagcttca
agaagaagagctgcaagttttttaagaaatattcagctaaaagatggtaaaacatcttta
caatatctttttgctagtgtaggtccaaaatataaagaccgtaatggtggatatacaaga
attatcaaattaccaaatcgtcaaggtgataattctaaaatgtctattattgaattagtt
taa

DBGET integrated database retrieval system