KEGG   Mycoplasma mobile: MMOB2630Help
Entry
MMOB2630          CDS       T00176                                 

Gene name
manB
Definition
(GenBank) phosphomannomutase
  KO
K01840  phosphomannomutase [EC:5.4.2.8]
Organism
mmo  Mycoplasma mobile
Pathway
mmo00051  Fructose and mannose metabolism
mmo00520  Amino sugar and nucleotide sugar metabolism
mmo01100  Metabolic pathways
mmo01110  Biosynthesis of secondary metabolites
mmo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MMOB2630 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    MMOB2630 (manB)
Enzymes [BR:mmo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     MMOB2630 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AAT27749
UniProt: Q6KI27
Position
complement(313249..314790)
Genome map
AA seq 513 aa AA seqDB search
MKELEFGTAGLRGILGKTKEHLNIFHVARVIEGFAKYLKSETFNWKNKIVIIGRDNRRKS
REFSRLAASILAFHKINVLISREIIATPIISYATKYHKALGAINITASHNPKEYNGIKLY
DKNGSQILPDVVDKIKSNFLNYEDYTKKQALNQFIFSIKNKYINYIPKQTLQSYEEKVLK
VGGSQKNLSNINLSFSPQHGTGAKIVKSIFKKLNVNAFFEEAQMKNDPDFTHTKSPNPED
KSSYENVIKLGLIHKSDAVLITDPDADRVGIGILRNNEYILLNGNETATLIFNYLIEINE
NKLQDKYLIYSFVSSSLPKKMAIENNIKWYEVATGFKYIGNLIEQIKNESKTSKLLFAFE
ESYGSLINDSLAYDKDAIQSCVILAKMISFYKKKSKTLLDVLEDIYKKYGYIKSESFSIN
LDEKNPLHLENIQSKFINLKFNEDFKIENFIKGKENIAPSNMIRISFQNLNWIALRPSGT
EAKIKFYLYVVDKDKILVEKNWNILKEKILSII
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattagaatttggaactgcaggattaagaggaattttaggtaaaactaaagag
catttgaatattttccatgtagcaagagtaattgaaggttttgcaaaatatttgaaatca
gaaacttttaattgaaaaaataaaattgtaataatcggaagagataatcgaagaaaatca
agagagttttcaagattggcagcaagtattttagcttttcacaaaataaatgttttaatt
tctagagaaattattgcgaccccaattataagttatgcaacaaaatatcataaggcactt
ggtgctattaatattacagctagtcataatccaaaagaatataatggaattaaactttat
gataaaaatggctcacaaattttgccagatgttgttgataaaattaaatctaatttttta
aattatgaagattatacaaaaaagcaagcactaaatcaatttatttttagtattaaaaat
aaatacataaattatattccaaaacaaactttgcaatcatatgaagaaaaagttttaaaa
gttggtggcagccaaaaaaatctatcaaatatcaatttatcttttagtcctcaacatgga
acaggtgctaaaatagttaaatctatttttaaaaaattaaatgtaaatgctttttttgaa
gaagcacaaatgaaaaatgatccggattttactcatacaaaaagtccaaatccagaagat
aaatcttcttatgaaaatgtaattaaattaggtttaattcataaatcagatgctgttcta
attacagatccagatgcagatagggtaggaattggaattttaagaaataatgagtacatt
cttctaaacggaaacgaaacagcaactttaatttttaattatttgattgaaataaacgaa
aataaattgcaagataaatatttaatttattcctttgtttcttcaagtttacctaaaaaa
atggcaattgaaaacaatataaaatggtatgaagttgctacaggatttaaatatatagga
aatttaattgaacaaatcaaaaatgaatcaaaaacttcaaaattattatttgcctttgaa
gaatcatatggatctctgataaatgattcattagcatatgataaagatgcaattcaaagt
tgtgtaattcttgcaaaaatgattagtttttacaaaaagaaaagcaaaacccttttagat
gttttagaagatatttataaaaaatatggatatattaaaagtgaaagtttttcaattaat
ttggatgaaaaaaatcctttgcatttagaaaatattcagtcaaaatttataaatctaaaa
tttaatgaagactttaaaattgaaaactttattaaaggtaaagaaaatattgccccgagt
aatatgataagaattagttttcaaaatttaaattgaatcgctcttagaccttctggaaca
gaagcaaaaattaaattttatctttatgttgttgataaggataaaattttagtagaaaaa
aattgaaatattttaaaagaaaaaattctttctattatataa

DBGET integrated database retrieval system