KEGG   Mycoplasma mobile: MMOB2640Help
Entry
MMOB2640          CDS       T00176                                 

Gene name
smpB
Definition
(GenBank) ssra-binding protein
  KO
K03664  SsrA-binding protein
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SmpB DUF4367 zf-U11-48K
Motif
Other DBs
NCBI-ProteinID: AAT27750
UniProt: Q6KI26
Position
complement(314847..315275)
Genome map
AA seq 142 aa AA seqDB search
MKIIIKNKDAFFNYEILEKYKAGLILKGWEVKSIRENKVQLKGAFITFKNDEAYITNMHI
SQYMSVKGNELEPRKLLLNKHEIRHIQDKKNRNSLAVIPLNLFWDNNYIKLEIALAKGKT
KADKRHRILEKDVRKHLKKITY
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcattataaaaaataaagatgccttttttaattatgagattcttgaaaaatat
aaggctggattgattttaaaaggatgggaagtaaaatctatcagagaaaataaagttcaa
ttaaaaggtgctttcatcacttttaaaaatgatgaagcatatattacaaatatgcatatt
tcacaatatatgagtgttaaagggaatgaattagaaccaagaaaattattactaaataaa
catgaaataagacatattcaagacaaaaaaaatcgtaattctttagctgtgattcccttg
aatttattttgggataataactatataaaattagaaattgctttagctaaaggaaaaacc
aaagctgataaaaggcatagaattttagaaaaagatgttagaaaacacttgaaaaaaata
acttattaa

DBGET integrated database retrieval system