KEGG   Mycoplasma mobile: MMOB2660Help
Entry
MMOB2660          CDS       T00176                                 

Gene name
ecm27
Definition
(GenBank) Ca2+/Na+ antiporter
  KO
K07301  cation:H+ antiporter
Organism
mmo  Mycoplasma mobile
Brite
KEGG Orthology (KO) [BR:mmo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmo02000]
    MMOB2660 (ecm27)
Transporters [BR:mmo02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   MMOB2660 (ecm27)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_Ca_ex
Motif
Other DBs
NCBI-ProteinID: AAT27752
UniProt: Q6KI24
Position
complement(317669..318736)
Genome map
AA seq 355 aa AA seqDB search
MNSTQQSIFPGINNLTSSPGIQFYIWFLFLLMAGILSFISLNLVKNAEIIIAKTKLGGAF
VGGVLISAITSMPEFITAVSQAGFGNAETGISDDLGSNAFAIFLIMITGLLLYRDLFLVK
VKGFTRVIILISLVSSLFYGIILLIGQDAIIGVVGQYAIGVIPAIFLIIYLISTYLQYKY
GGDDEVHETVLKEKFKNKNVRKTFFWFIIWAILLCAASLGVNFIINGMQIVYGIDSNSAG
GLILAITTSLPEIISFGFFMKNKQPIAAFGTLIGSAIFNNSLIFWADLAFRQNSIVIGQR
GSDTFAIAFLVAGLLALLSLIIFFPKFFSKKRYYFIIPALGVISFVVGWSLIIAY
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaactcaacaatcaatttttccagggataaataatctaacttcatcacctgga
attcaattttatatttgattcttatttttactaatggctggaatactttcttttatttct
ttaaatttagtaaaaaatgcagaaatcattattgcaaaaactaaattaggaggagctttt
gttggaggagttttaattagtgcaattacttcaatgccagaatttattactgctgtttct
caggcaggttttgggaatgctgaaactggaattagtgatgatcttggttcaaatgctttt
gctatttttttaataatgataaccggattactactttatcgggacttatttttagttaaa
gtaaaaggttttacacgagtaattatccttatttctttagtaagtagtttattttatgga
attattttattaattggacaagatgcaattataggagttgttggacaatatgcaatagga
gttattccagcaatatttttaattatttatttaatttcaacatatcttcaatataaatat
ggcggagatgatgaagttcatgaaactgttttaaaagaaaaatttaaaaataaaaatgta
aggaaaacatttttttggttcattatatgagcaattttactttgtgcagctagtcttgga
gtgaattttattattaatggaatgcaaattgtttatgggatagattccaattctgcagga
ggactaattttagcaattacaacttcattgcctgaaataatttcttttggtttttttatg
aaaaacaaacaaccgattgctgcttttgggactttaattggaagcgcaatttttaataat
tcattgattttttgagcagacttggcatttagacaaaattcaattgttataggacaacgt
ggtagtgatacatttgccattgcatttttagtagctggtttactagctcttctttcttta
attatcttttttccaaaattttttagtaaaaaaaggtattattttattattccagcatta
ggtgtaattagttttgttgttgggtgatcattaattattgcttattaa

DBGET integrated database retrieval system