KEGG   Mycoplasma mobile: MMOB2730Help
Entry
MMOB2730          CDS       T00176                                 

Gene name
hisS
Definition
(GenBank) histidyl-tRNA synthetase
  KO
K01892  histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
mmo  Mycoplasma mobile
Pathway
mmo00970  Aminoacyl-tRNA biosynthesis
Module
mmo_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    MMOB2730 (hisS)
Enzymes [BR:mmo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.21  histidine---tRNA ligase
     MMOB2730 (hisS)
Amino acid related enzymes [BR:mmo01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   MMOB2730 (hisS)
Transfer RNA biogenesis [BR:mmo03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MMOB2730 (hisS)
 Prokaryotic Type
    MMOB2730 (hisS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His tRNA-synt_2b tRNA-synt_2d CG-1
Motif
Other DBs
NCBI-ProteinID: AAT27759
UniProt: Q6KI17
Position
327518..328855
Genome map
AA seq 445 aa AA seqDB search
MMWYNLTIKQLKNVRNFMIQKPKGTSDFFLEKADLFQYILDTFRKEAELFNYSYIQTPIL
EFYDLFYRSVGETTDVVSKEMFIFNDRSERKMALRPEKTAGVIRSLVENKLIFNAENKFY
YYGSMFRYERPQKGRYREFTQIGCEWIEDNSDFSDFEILLFASKFLGNFNFNKVILKINN
LGNKVERENYLIELKKYFYKFKDKFDEISLKRLEKNPLRILDDKEINHQDFIKNAPKLFD
FLNSETVQKFNNLQNYLRKSNISFEIDYSLVRGFDYYNNLVFEFVYYDEESRSELTILGG
GRYSNLIEELGGPKKDAIGFAAGVERLMILLKEKEWEKPIKTSIFVFNKDHEDLYKNFDF
VYKLRKRDLVVKQNVSNFKLQKIYSKIVNEGIKFLIFFDEKLNQIIIKNLINKNFLDLTN
KSQEEKINLVKKFIESENKNENNSK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggtataatttaacaattaagcaacttaaaaatgttaggaattttatgatacaa
aagccaaaaggaacaagtgatttttttcttgaaaaagcagatttatttcaatacatatta
gatacttttagaaaagaagctgaattatttaactatagttacattcaaactccaatttta
gaattttatgacctattttatcgttctgttggtgaaacaacagatgttgtttctaaggaa
atgtttatttttaatgatagaagcgaaagaaaaatggctttaagaccagaaaaaacagct
ggagtaattagatctttagttgaaaataaattaatttttaatgcagagaataaattctac
tactatggatctatgtttagatatgaaagaccccaaaaaggaaggtatagagaatttaca
caaattggttgtgaatgaatagaagataatagcgatttttcagattttgaaattttacta
ttcgcttcaaaatttttaggcaatttcaactttaataaagttattttaaaaataaataat
ttaggaaataaagttgaaagagaaaattatttgattgaattaaaaaaatatttttataaa
tttaaagataaatttgatgagatttctttaaaaagattagaaaaaaatcctttaagaatt
ttggatgataaagaaattaatcaccaagattttataaaaaatgctccaaaattatttgat
tttttaaattctgaaacagttcaaaaatttaataatttgcaaaattatctaagaaaaagc
aacattagttttgaaattgattattctttagttagaggatttgattattacaataattta
gtttttgagtttgtctattatgacgaagaatctagaagtgaattaacaattttaggtggt
ggaagatattcgaatttaatcgaagaacttggcggtccaaaaaaagatgcaattggtttt
gcagctggtgtggaaagattaatgattttattaaaggaaaaagagtgagaaaaaccaata
aaaacttcgatttttgtttttaacaaagatcatgaagatctttataaaaattttgatttt
gtttataaattgagaaaaagggatttagtagtgaaacaaaatgtatctaattttaaattg
caaaaaatttattctaaaattgttaatgaaggtattaaatttttaatcttttttgatgaa
aaattaaatcagataattatcaaaaatttaataaataaaaattttttagatcttacaaat
aaaagtcaagaagaaaaaattaatttagtaaaaaaatttatagaaagcgaaaataaaaat
gaaaacaattctaaataa

DBGET integrated database retrieval system