KEGG   Mycoplasma mobile: MMOB2760Help
Entry
MMOB2760          CDS       T00176                                 

Gene name
nadD
Definition
(GenBank) bidomainal protein
  KO
K00969  nicotinate-nucleotide adenylyltransferase [EC:2.7.7.18]
Organism
mmo  Mycoplasma mobile
Pathway
mmo00760  Nicotinate and nicotinamide metabolism
mmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MMOB2760 (nadD)
Enzymes [BR:mmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     MMOB2760 (nadD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like HD HDOD
Motif
Other DBs
NCBI-ProteinID: AAT27762
UniProt: Q6KI14
Position
331813..332895
Genome map
AA seq 360 aa AA seqDB search
MNKIGIFGGSFDPIHIAHTFVAEESIKILNLDKLFFVPTFINPDKIGRKSASPEDRINMI
NLVKPEKSEVSLFEINRKNISYSIDTLKYFKSKYPNDQLFFIIGSDNINKINKWEGIDWI
YQNVQIVVFRREKLINKINIKKYKAILLDNKILDYSSSNYKKGNTFLVDKKVQCYIGKNL
LYGQDIAINNLEAKRYKHSVATEVMATKIAKKLNFDLKAAAFSGLMHDITKNWDIEEHYK
FLEEQNYPNFNKVEKHKLHQISASIWLKNIFLVENEQIINSIGCHTTLKNDLSLLDKIVF
VADKICEGRKYEGIQKVRKLALENFDEAFKLVVKRTWDFNLEKNIPLSEEQINIYRKWSQ
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaattggaatcttcgggggaagttttgaccctattcacatagcccatactttt
gttgcagaagaatctatcaaaattttaaatcttgataaattgttttttgttccaactttt
attaatccagataaaattggaagaaaaagtgcgagccctgaagatagaattaacatgatt
aatctagttaaacctgaaaaaagtgaagtttctctatttgaaataaatagaaaaaatatt
agttattccattgatactttaaaatattttaaatctaaatatccaaatgatcaacttttt
ttcattattggcagtgataatatcaacaaaataaataaatgagaaggaattgattgaatt
tatcaaaatgtacaaatagttgtttttagaagagaaaaacttattaataaaattaacata
aaaaaatataaggccattttattagataataaaatcttagattattcttcttctaattat
aaaaaaggaaatacatttttagttgataaaaaagttcaatgttacatcgggaaaaatctt
ttatatggccaagatattgctattaataatttagaagcaaaaagatacaaacactcagtt
gcaacagaagttatggcaacaaaaatagcaaaaaaactaaattttgacttaaaggcagct
gcctttagtggtttgatgcatgatattacaaagaattgagacattgaagaacattacaaa
tttttagaagaacaaaattatccaaattttaataaagtagaaaagcacaaattacatcaa
ataagtgcttctatttgattaaaaaatatttttcttgttgaaaatgagcaaattataaat
tcaattggatgccatacaactttaaaaaatgatttatccctattagataaaattgttttt
gttgcagacaaaatttgtgaaggaagaaaatatgaaggaattcaaaaagtaagaaaactt
gcattagaaaattttgatgaagcttttaaacttgttgtgaaacgaacatgagattttaat
cttgaaaaaaatattcctttatctgaagaacaaataaatatttatagaaagtgatctcaa
taa

DBGET integrated database retrieval system