KEGG   Mycoplasma mobile: MMOB2780Help
Entry
MMOB2780          CDS       T00176                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraX Pox_A14
Motif
Other DBs
NCBI-ProteinID: AAT27764
UniProt: Q6KI12
Position
complement(333543..334424)
Genome map
AA seq 293 aa AA seqDB search
MKKCIQNPKKWMWNKNFIDNNISIKFLGGIALKIIAVVFMFVDHFGLIVFPQNDILRILG
RISMPLFAFLIAIGMNYTSNRKKYLFRLLIYFIILQIPITIFLLISNTNLGKGYVNIFFN
LSTGAGFIYIYKYKKIWSIPYLILISIFLILNDVPEFSSPIDVDYGWYGFYLIIGFFFSF
EFTKNLKTKYSFLISKLFAIIILISLTLIWVNVSYLWLSLSNSSIPILSTISKRGIYDFS
NKFQIYALFAIPFILFFKAKKEKSTSIVKYSFYLAYPLSFFIPTLISMIISIV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatgtattcaaaatccaaaaaaatgaatgtgaaataaaaattttatagataat
aatatttctattaaatttttaggcggaattgctttaaaaataattgctgttgtttttatg
tttgtggaccattttgggcttattgtttttcctcaaaatgacattttaagaatactagga
agaatttcaatgcctctatttgcatttttaattgcaattggaatgaattatacaagtaat
cgaaaaaaatatttatttagattactaatttatttcattattctacaaatccctattaca
atttttcttcttatttcaaatacaaatcttggtaaaggatatgttaatattttttttaat
ttatcaacaggtgctggatttatttatatttacaaatataagaaaatatgatctattcca
tatcttattttaataagtatatttttgattttaaatgatgtaccagaattttcctctccg
attgatgtagattatggttgatatggtttttatttaataataggatttttctttagtttc
gaatttacaaaaaatttaaaaacaaaatatagttttttaatttcaaaattatttgcaata
attattttaatatctcttacacttatttgagtaaatgtaagttatctttgactaagtcta
tctaatagttcaattccaattttatctacaatttcaaaaagaggaatttatgatttttca
aataaatttcaaatttatgctttatttgcgattccttttattttatttttcaaagccaaa
aaggaaaaatcaacttcaatcgtcaaatatagcttttatttagcttatccattatctttt
tttattccaacactaattagcatgattattagtattgtctaa

DBGET integrated database retrieval system