KEGG   Mycoplasma mobile: MMOB2790Help
Entry
MMOB2790          CDS       T00176                                 

Gene name
tpx
Definition
(GenBank) thiol peroxidase
  KO
K11065  thiol peroxidase, atypical 2-Cys peroxiredoxin [EC:1.11.1.15]
Organism
mmo  Mycoplasma mobile
Brite
Enzymes [BR:mmo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     MMOB2790 (tpx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AAT27765
UniProt: Q6KI11
Position
334495..334992
Genome map
AA seq 165 aa AA seqDB search
MKRTVMFSDKEFELVGPQLKLGDKVTFKATSKTLESVTIDKLEKITVLTIFPSISTSICD
VQTSEMSKIASEFTNFNFVAISLDLPFTLKEWCGTKNVKNIEVLSDYREREFGKKYGFLI
DDLFLLSRGTIVLDKSNKVIYIEQLKQVKTQIDFEKLRNFLKTIK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaacagtaatgttttcagacaaagaatttgaattagttggtccacaattaaaa
ttaggagacaaagttacattcaaggcaacttcaaaaacattggaatcagtaacaattgat
aaattagaaaaaattacagtacttactatttttccctcaattagtacttctatttgtgat
gttcaaacaagcgaaatgtcaaaaattgctagcgaatttacaaattttaattttgttgca
atttcattagatttaccatttacattaaaagaatgatgtggtactaaaaatgtaaaaaac
attgaagtcttaagtgattacagagaaagagaattcggaaaaaaatacggatttttaatt
gatgatttatttttattaagtagaggaactattgttttagataaatcaaataaagtaatt
tatattgagcaattaaaacaagtaaaaactcaaattgattttgaaaaattgagaaatttc
ttaaaaacaattaaataa

DBGET integrated database retrieval system