KEGG   Mycoplasma mobile: MMOB2810Help
Entry
MMOB2810          CDS       T00176                                 

Gene name
rpoB
Definition
(GenBank) DNA-directed RNA polymerase beta chain
  KO
K03043  DNA-directed RNA polymerase subunit beta [EC:2.7.7.6]
Organism
mmo  Mycoplasma mobile
Pathway
mmo00230  Purine metabolism
mmo00240  Pyrimidine metabolism
mmo01100  Metabolic pathways
mmo03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MMOB2810 (rpoB)
   00240 Pyrimidine metabolism
    MMOB2810 (rpoB)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    MMOB2810 (rpoB)
Enzymes [BR:mmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     MMOB2810 (rpoB)
Transcription machinery [BR:mmo03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     MMOB2810 (rpoB)
DNA repair and recombination proteins [BR:mmo03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      MMOB2810 (rpoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_3 RNA_pol_Rpb2_7 RNA_pol_Rpb2_1 RNA_pol_Rpb2_2 RNA_pol_Rpb2_45 TSC22
Motif
Other DBs
NCBI-ProteinID: AAT27767
UniProt: Q6KI09
Position
337077..340643
Genome map
AA seq 1188 aa AA seqDB search
MIKHKLRKFGPVTERRDYSQTNRTWETFDFLETQKKSFKWFIDEGINQALNDIYPIHSNN
GKVIIEYVNNSAKLEYKTDNEYKILAEARQKGTTYSGILKAKLTKTIVETGEIETAEVLY
GDVPIMTSGGTFLINGSEKIIVSQLIRSPGAYFGLKVRNKQADDLFNKLEIIPKLGSWIE
ISHRVTGNTTDTVKVKIDKHKAVSLVTFLRAMGMKKETIQNLFGSHSTLEGENPILKETL
NKEKFKTEDDALEYLYSVIWRGNNRITAESKSNLLSNILFNPRRYNLSKTGRYMLNRKLS
LVDRIIGTYLAEDLFSAKGTKNAKLVFAKGTLITREIAEKIQDSFKNNIFNLIPIPDVSS
DIYAAQLETNPKLAERIRVISLNIYPNKTWMEQNTNPIIVIANDPNSTELHLLASDLVAI
VSYYFNLVDRVGQDDDPDSLINKRIVGVGELLENQFKIGLSKLEKNAKERMSAKEIEKIT
PKNITNSKPVYNQFKTFFNSSKLSQFMDQVNPLAEISNKRRVTSLGPGGLNRETAQFEVR
DVHSTHYGRICPIETPEGPNIGLILNFATYAKVNDFGFIQSPYFKVNDGIIDYEKPIFLT
AAEEIDKKFAQSTVSVDKDGKITTQNITVRQNHDYLIVSPSEVDYIDISSKQMTSIAAAA
IPFLENNDANRALMGSNMQRQAIPLLEAEAPLVATGIEADIAKFSVSNLIVKEEGEVSYV
DGTKIKVKSKNDKSKTYYLKNFEHSNQGTLLSQKPIVKLGDKVEIGDLLTDASSFKDGEM
ALGKNVMIAFSTWNGYNYEDAIVISERLVKDDVFTSVHIEDQTIQFRTSKAGSDKLTREI
PNVSNFSKRNLDEEGIVKVGSEVVAGDILVGRVSPKGEENPSPEEKLLAAIFQKKPSTDK
DTSLKVKHGHAGTVLDVQVLSRASGDVLEDSVEKIVKVSIAQKRKIKVGDKMAGRHGNKG
VISIVAPVEDMPHLEDGTVIDIILNPQGVPSRMNIGQVLELHLGMAAKTLSTKFVSPGFD
GLKFGTIQEILKEAKLPENGKFTLIDPMTGEKFDNKVSVGIMYMLKLSHMVDDKMHARSI
GPYSLITQQPLGGKSQNGGQRFGEMETWALEAHGASNILQEILTYKSDNIEGRKGLYNSL
ATGNKIPAPGTPESFNVLSYELRGLSIKLESQAHFKNAQIVKEVMDNE
NT seq 3567 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacacaaattaagaaaattcggaccagttacagaaagaagagactattcacaa
acaaatagaacatgagaaacatttgattttttagaaactcaaaaaaaatcttttaaatga
tttattgatgaaggaatcaatcaagctttaaatgacatttatccaatccattcaaataat
ggaaaagttataattgaatatgtaaataattcagcaaaacttgaatacaaaacagacaat
gaatacaaaattttagcagaagcaagacaaaaaggtactacttatagtggtattttaaaa
gcaaaattaactaaaactattgttgaaacaggagaaattgaaactgcagaagttttatat
ggtgatgttccgattatgacttcaggaggaacttttttaattaatggtagtgaaaaaatt
attgtttcacaattaattagatctccaggagcttattttggtcttaaagtaagaaataaa
caagctgatgatctatttaataaattagaaattattcctaaattaggttcttgaattgaa
atttctcacagagttacaggaaacacaacagatacagttaaagtaaaaattgacaaacat
aaagctgtttctctagtaacttttttaagagcaatgggaatgaaaaaagaaactattcaa
aatttatttggtagtcatagtactttagaaggtgaaaaccctattttaaaagagacttta
aataaagaaaaattcaaaacagaagatgatgctttggaatatttatatagtgtaatttga
agagggaacaacagaattactgctgaatcaaaatcaaatttattatcaaatattttattt
aatccaagaagatataatctatccaaaacaggtagatatatgcttaatagaaaattaagt
ttagtagatagaattattggaacttatttagcagaagatttattttctgctaaaggaaca
aaaaatgcaaaactagtttttgccaaaggaactttaattactagagaaatcgctgaaaaa
attcaagatagttttaaaaataatatttttaatttaattccaattccagatgtgagttca
gatatttatgctgcacaattagaaacaaacccaaaattagctgaaagaattagagttatt
tcattaaatatttatccaaataaaacatgaatggagcaaaatacaaatccgattattgtt
attgctaatgatcctaattctacagaattacatttacttgcaagtgatcttgttgcaatt
gtttcatattactttaatttagttgatcgtgttggtcaagatgatgaccctgattcttta
attaataaaagaattgttggagtcggtgaattgttagaaaatcaatttaaaataggactt
tcaaaattagaaaaaaatgcaaaagaaagaatgtctgctaaagaaattgaaaaaattact
cctaaaaacattacaaattcaaaacctgtttataatcaattcaaaactttttttaactct
tctaaactttcacaatttatggatcaagtcaatcctttagctgaaattagcaataaaaga
agagtaacttcacttggaccaggtggacttaatcgtgaaaccgctcaatttgaagtacgg
gatgttcattcaactcactatggaagaatttgtccaattgaaacaccagaaggaccaaat
attggactaattttaaactttgcaacttatgcaaaagttaatgattttggatttattcaa
tctccatactttaaagtaaatgatggaatcattgattatgaaaaacctatttttctaact
gctgcagaagaaattgataagaaatttgctcaatcaactgtaagtgttgataaagatgga
aaaattacaactcaaaatattactgtaagacagaatcatgattatttaattgtttcacca
agtgaagttgattatattgatatcagtagtaaacaaatgacttcaattgcagcagcagca
attcctttcttggaaaataatgatgccaatagagcacttatgggttcaaacatgcaaaga
caagcaattcctcttcttgaagctgaagctcctttagttgcaactggaattgaagcagat
attgctaaattttcagtttccaatttaattgtaaaagaagaaggtgaagtttcttatgtt
gatggaactaaaattaaagttaaatcaaaaaacgacaaatctaaaacttattacttaaaa
aacttcgaacattcaaatcaaggaactctattatcgcaaaagccaattgtaaaacttgga
gataaagtcgaaataggagatttattaacagatgcttcttcatttaaagatggagaaatg
gctctaggtaaaaatgttatgattgctttttcaacttgaaatggttataactatgaagat
gcgattgttattagtgaaagattagtaaaagatgatgtctttacttctgttcatattgaa
gatcaaacaattcaatttagaacttcaaaagctggtagtgataaattaactagagaaatt
ccaaatgtatctaatttttcaaaaagaaatttagatgaagaaggaattgttaaagttggt
tctgaagttgttgctggagatattttagtaggacgtgtttcgccaaaaggtgaagaaaat
ccaagtcctgaagaaaaattacttgctgctattttccaaaaaaaaccttcaacagataaa
gacacttctttaaaagtaaaacacggacatgctggaactgttttagatgttcaagttctt
tcaagagcttcaggtgatgtacttgaagatagtgttgaaaaaattgttaaagtttcaatt
gctcaaaaaagaaaaatcaaagttggagataaaatggcaggacgtcatggaaataaaggg
gttatttctattgttgctcctgttgaagacatgccacatctagaagatggaactgttatt
gatattattttaaatcctcaaggtgttccttcaagaatgaacattggtcaagttttagaa
ttacacttaggtatggccgctaaaactttatcaactaaatttgtttctccaggttttgat
ggattaaaatttggaacgattcaagaaattttaaaagaagcaaaattgcctgaaaatggt
aaatttactttaatagatccaatgacaggtgaaaaatttgataataaagtaagtgttgga
attatgtatatgttaaaactttcacatatggttgatgacaagatgcacgcaagaagcata
ggaccatattctttgattactcaacaacctcttggaggaaaatctcaaaatggtgggcaa
agatttggagagatggaaacttgagctttagaagctcatggagcttcaaatatcttacaa
gaaatcttgacttataaatcagataatattgaaggtagaaaaggattatataattcttta
gcaactggaaataaaattcctgctcctggaactcctgaatcattcaatgttctttcatat
gaattaagaggattaagtattaaattagaatctcaagctcattttaaaaatgcacaaata
gtaaaagaggtaatggataatgaataa

DBGET integrated database retrieval system