KEGG   Mycoplasma mobile: MMOB2850Help
Entry
MMOB2850          CDS       T00176                                 

Gene name
hsdS
Definition
(GenBank) restriction-modification enzyme mpuUVIII s subunit
  KO
K01154  type I restriction enzyme, S subunit [EC:3.1.21.3]
Organism
mmo  Mycoplasma mobile
Brite
Enzymes [BR:mmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     MMOB2850 (hsdS)
Prokaryotic defense system [BR:mmo02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   MMOB2850 (hsdS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methylase_S Laps P22_AR_N
Motif
Other DBs
NCBI-ProteinID: AAT27771
UniProt: Q6KI05
Position
349756..350898
Genome map
AA seq 380 aa AA seqDB search
MKKIYKSQNEPLSKKIEVIKTDKIFEINKGRSKISKKDISDNHGIYPVYSSKTTNNGILG
WINRYDYNDELITLTSEGYAGTAFYHINEKFNVTGDSFVLKVKNKDITNTKFMFYFLQKE
AKNPSNLNLLNNFSGTLTKSNLSKIEIPLPPIQYQDEIVRILNNFSEILLDLKKEFELRK
KQYEYYRNKLFLFSEQTEYVSIDKIFEINKGKSKISKKDISDNPGIYPVYSSKTTNNGIL
GWINRYEDQYEDELITITVGGYAGTVFYHDNKKINVTEGSWILKAFDKNNVNIKFVFYAL
EIIAKKYVTKSSTMLELKKSSIEKIKIPLPSIEIQNKIVKNLNFFEILIKDFKEGLPSEI
NLRKKQYEYYRDKLLKFDLN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatatataaatcacaaaatgaacctttatcaaaaaaaatagaagttataaaa
acagataaaatatttgaaataaataagggtagaagcaagatatcaaaaaaagatataagt
gataatcatggaatttatcctgtatattcatcaaaaactactaataatggaatacttgga
tgaattaatagatatgattacaatgatgaattaattactttaacatcagaaggatatgca
ggaactgctttttatcatattaatgaaaaatttaatgtaacaggagattcttttgttttg
aaggtaaaaaataaagatataacgaatacaaaatttatgttctattttttacaaaaagaa
gcaaaaaatccttcaaatttaaatttacttaataattttagtggaacacttacaaagtca
aatttatctaaaatagaaattcctttacctcctattcaatatcaagatgaaattgttaga
attttaaataatttttcagaaattttattagaccttaaaaaagagtttgaattaagaaaa
aaacaatatgaatattatcgaaataaattatttttatttagtgagcaaacagaatatgtt
tcaatagataaaatatttgaaataaataagggtaaaagcaagatatcaaaaaaagatata
agtgataatcctggaatttatcctgtatattcatcaaaaactactaataatggaatactt
ggatgaattaatagatatgaagatcaatatgaagatgaattaattacaataacagtaggt
ggttatgcaggaactgttttttatcatgataataaaaaaataaatgttacagaaggtagt
tgaatattaaaagcatttgataaaaataatgtaaatataaagtttgtattttatgcttta
gaaataattgcaaaaaaatatgtaaccaaaagctcaacaatgctcgaattaaaaaaatct
tcgatagaaaaaataaaaattcctttaccgtcaattgaaattcaaaacaaaattgtgaaa
aatcttaattttttcgaaattttaattaaagattttaaagaaggattaccatctgaaata
aatttaagaaaaaaacaatatgaatattatcgtgataaattactaaaatttgatctaaat
taa

DBGET integrated database retrieval system