KEGG   Mycoplasma mobile: MMOB2900Help
Entry
MMOB2900          CDS       T00176                                 

Gene name
potE
Definition
(GenBank) amino acid permease
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease NdhL
Motif
Other DBs
NCBI-ProteinID: AAT27776
UniProt: Q6KI00
Position
356201..357811
Genome map
AA seq 536 aa AA seqDB search
MSPKTKQISFLSALVVVVGTVIGAGIFFKNKFVISTTSTVNAGIAQANIGAAISAWIISA
IGIIAIAVCLIELATATKNDKGILAWVKNFTKKWMSRFASSYMLIFYLPLTTLALSFFVV
QAIQDASGNSFQLDGWVASAIAFGLFAWIALTSFFSIKAAGILQWIFTIGGNALPLLIIP
IIAFFNPGNSVDPNFVANSNLNQPTGLSQLFVGFGILAAIPSIMFSFDGFYTATALRSKL
KDPNKLPSIMIVGLIIVTVLYLFLTIGFVIGSADGTSNGVFGTNIIPRWLQIILSSFIAL
AVMSTLNGYALSSAPIFKATDEEKELHFIGWFKRVFKIKDQLTAAFLVFFAIVSISYLII
IPVGLYAWQIGEVKTYGSAGLLYNFVDIITNFASIMAYLFIGVSIHGALINRKKNFVKVK
KYKYFVPVAWIALIFVYISVVFFFIDSIVSIPLSNVQVFNDHVGIIDQVGSRTASLNNMV
TAIVRLGFFIFSFAVCVGITLIESWIEKKYYKNKSKPVIVDEVEELEKISKKLINS
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccaaaaacaaaacaaataagtttcttatctgctttagttgttgttgtaggaaca
gtaattggagcaggaatttttttcaaaaataaatttgttatttcgacaacaagcacagta
aatgcaggaattgcccaagcaaatataggtgctgcaatttcagcatgaattatttcagca
attggaattattgctattgctgtttgcttaattgaattagcaactgcaacaaaaaatgat
aaaggaatattagcttgagttaaaaactttacgaaaaaatgaatgtcaagatttgcaagt
tcatatatgttaattttttatttacctctaacaacacttgctttatcatttttcgttgtt
caagcaattcaagatgcctcaggaaattcgtttcaattagatggatgagtagcttcagca
attgcatttggactttttgcatgaattgccttaacaagcttttttagtataaaagcagct
ggaattttacaatgaatttttacaattggaggaaatgctttaccacttttgattattccg
atcattgcattttttaaccctggaaatagcgttgatccaaattttgtcgctaatagtaat
ttaaatcaaccaacaggattaagtcaattgtttgttggatttggaattttagcagctatt
ccttcaattatgttctcatttgatggattttatacagcaacagctttaagatcgaaatta
aaagatcctaacaaattaccttcaattatgattgttggattaattatagttactgtatta
tatttattcttaacaattggatttgtaattggttcagcagatggaacaagtaatggagtt
tttggaactaatattattccaagatgattacaaataatactatcttcatttattgcttta
gcagttatgtccacactaaatggatatgctttatcttcagctcctatttttaaggctact
gatgaagaaaaagagttacattttataggttgatttaaaagagtctttaaaattaaagat
caattaacagcagcattcttagtattttttgcaattgttagcatttcttatttaataatt
attccagtaggtctatatgcttgacaaattggtgaagtaaaaacttacggatcagctgga
ttattatataattttgttgatattattacaaactttgcttcaattatggcttatctattt
attggagtttctattcatggagctttaattaacagaaagaaaaactttgtaaaagttaaa
aaatataaatattttgtacctgttgcatgaattgctttgatttttgtttatatttctgtt
gtctttttctttattgattcaatcgtttctattcccttatcaaatgttcaagtattcaat
gatcatgttggtataatagatcaagttggctcaagaactgcatcattaaacaatatggtt
acagcaatagttagattaggatttttcatattctcttttgcggtttgtgttggaataaca
cttattgaaagttgaattgaaaaaaaatattataaaaataaatctaaaccagttattgtt
gatgaagttgaagaattagaaaaaatttctaaaaaactaataaatagttaa

DBGET integrated database retrieval system