KEGG   Mycoplasma mobile: MMOB2910Help
Entry
MMOB2910          CDS       T00176                                 

Gene name
dnaG
Definition
(GenBank) DNA primase
  KO
K02316  DNA primase [EC:2.7.7.-]
Organism
mmo  Mycoplasma mobile
Pathway
mmo03030  DNA replication
Brite
KEGG Orthology (KO) [BR:mmo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MMOB2910 (dnaG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmo03032]
    MMOB2910 (dnaG)
Enzymes [BR:mmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.-  
     MMOB2910 (dnaG)
DNA replication proteins [BR:mmo03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    MMOB2910 (dnaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-CHC2 Toprim_N Toprim_4 Toprim_2 Toprim_3 Toprim
Motif
Other DBs
NCBI-ProteinID: AAT27777
UniProt: Q6KHZ9
Position
complement(357822..359666)
Genome map
AA seq 614 aa AA seqDB search
MEYKNIFDELLSQVDIVTVINNHLSLIKKGKNYIAICPFHEDSKPSLTVSVEKQVFKCFA
CNVGGNAISFVEKFLKISFLEASKMIAQENGINLEFSEKKQQRVILTKTQEQIIEANNLA
LSFYKYNIFDKQNKSLVSFLNSRNINDANLIDFFELGFASNENLKEKIMKKDSTINEAIL
SVASLINSKNGNFFENRMIFPIKDENDFLVGFSGREIVPNSNNVKYLNTSENAIFNKGNV
LYNFNKAKEFITYKKELIICEGFMDVIALYKIGIKNVTALMGTSFSNNHIKLFNNIKDIK
IVFFLDGDLAGKNATIKSINKIIKYKFEIEIINNPLKMDPDEILNRLGQSRLEEIVKSRK
NVFEFLLDYFLEINSLNNSEKIIDFCKIYSQYLQHAKQDIKIIILDKIKKTEKIPQELID
KYFAFKTNNLENQDYNVLDFDQNYKNTYQKENKYKANYQNNFWNINDFKFWQLNQSEKVI
LSLFDSYRKDPKKELIVLFSIKKNDFVLKNLALNEIAEKLVTSLDKKEVIKASELFDSKE
KEFIDNLLKQKYLINYPKFNESKNFEILLESLKNYESSSLLINEIGIKLKNNENIDDSTL
EIMKKEFLKNKKAY
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggaatataaaaatatttttgatgaattgctttctcaagttgacattgtaactgtaata
aacaatcatttatctttaattaaaaaagggaaaaattatatagctatttgtccttttcac
gaagactcaaaaccttcattaactgtttctgtagaaaaacaagtttttaaatgttttgca
tgtaatgttggtggaaatgcaattagttttgttgaaaaatttttaaaaataagcttttta
gaagcaagtaaaatgattgctcaagaaaatggaattaatcttgaattttctgaaaaaaaa
caacaaagagtgattttaacaaaaactcaagagcaaattattgaagctaataatttagct
ttgagtttttacaaatacaacatttttgacaagcaaaataaaagtttagttagtttttta
aattcaagaaatattaatgatgcaaatttaatagatttttttgaactaggttttgcttct
aatgaaaatttaaaagaaaagatcatgaaaaaagattctacaatcaatgaagcaatttta
tccgttgcttcattgataaattctaaaaatggaaatttttttgaaaatagaatgattttt
ccaattaaagatgagaatgattttttagtaggttttagtggaagagaaattgttccaaat
tcaaataatgttaaatatttaaacacatcagaaaatgcaatttttaataaaggtaatgtt
ttatataattttaataaagctaaagagtttattacttacaaaaaggaattaattatttgt
gaagggttcatggatgtaattgctttatataaaatcggaatcaaaaatgttactgcttta
atggggacatctttttcaaacaatcatataaaactatttaataacatcaaagacataaag
attgtcttttttcttgatggtgatttagctggtaaaaatgcaacaattaaatctattaat
aaaattattaaatataaatttgaaatcgaaataattaacaatcctttgaaaatggaccca
gatgaaattttaaacagattaggtcaatctagattagaagaaattgtaaaatcaagaaaa
aatgtttttgagtttcttctagactatttcttagaaataaattcattaaataattctgaa
aaaataattgatttttgcaaaatttattctcaatacttgcaacatgcaaagcaagatata
aaaattatcattttagataaaatcaaaaaaactgaaaaaattcctcaagaattgattgat
aaatattttgcttttaaaacaaataatttagaaaatcaagattataatgttttagatttt
gatcaaaactacaaaaatacttaccaaaaagaaaataagtataaggctaattatcaaaat
aatttttgaaacataaatgattttaaattttgacaattaaatcaaagtgaaaaagttatt
ttatctctatttgattcttatagaaaagatcctaaaaaggaattgattgttttattttca
attaaaaaaaatgattttgttttgaaaaatttagcattgaatgaaattgcagaaaaatta
gttacttctttagataaaaaagaagtaataaaagctagtgaattatttgattctaaagaa
aaagaatttattgataatttattaaaacaaaaatatttaataaattatccaaaatttaat
gaaagcaaaaattttgaaattcttctagaaagtttgaaaaattatgaatcaagctcgcta
ttaattaatgaaataggaatcaaattgaaaaacaatgaaaatattgacgattcaactttg
gaaattatgaaaaaagaatttttaaaaaataaaaaagcctattag

DBGET integrated database retrieval system