KEGG   Mycoplasma mobile: MMOB2920Help
Entry
MMOB2920          CDS       T00176                                 

Gene name
glyS
Definition
(GenBank) glycyl-tRNA synthetase
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
mmo  Mycoplasma mobile
Pathway
mmo00970  Aminoacyl-tRNA biosynthesis
Module
mmo_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mmo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MMOB2920 (glyS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmo01007]
    MMOB2920 (glyS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmo03016]
    MMOB2920 (glyS)
   03029 Mitochondrial biogenesis [BR:mmo03029]
    MMOB2920 (glyS)
Enzymes [BR:mmo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     MMOB2920 (glyS)
Amino acid related enzymes [BR:mmo01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   MMOB2920 (glyS)
Transfer RNA biogenesis [BR:mmo03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MMOB2920 (glyS)
Mitochondrial biogenesis [BR:mmo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MMOB2920 (glyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HGTP_anticodon tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: AAT27778
UniProt: Q6KHZ8
Position
complement(359656..361032)
Genome map
AA seq 458 aa AA seqDB search
MSKNNKLVNLINHLKTQGFVYQGSEIYGGLANTWDYGPLGSLLLNNIKNEWIKYFIHNEE
NNFLIDAKILMNPEVWKTSGHVGNFSDPLIENKINNKRYRADHLIEEFDPLMKIETLSEI
EMENFIKRNITKYEGVATDWTSIRKFNLMFETYQGILEDSKNKIYLRPETAQAIFVNFKN
ILRTTRTKIPFGVGQIGKSFRNEVTPGNFIFRTREFEQMELEYFVHPNDSDKAFEYYLKK
CYEFLIFLGIKKDLLKIRKHAKEELSHYSSATSDIEFKFDFGWGELLGVANRGDFDLSSH
SKATNEELSYFDSIENITYIPHVIEPSMGLDRLALAILTSSYEEETLEVDSRVVLKLNKF
LVPYQIAVLPLVKKFSEESKELVKWLKQHNFRTTYDESASIGKRYRRQDAIGTFFALTYD
YQSAENQSFTIRNRDTMEQIRINKIDLISYLTKELNGI
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaataataaattagtgaatttaattaatcatttaaaaacacaaggttttgtc
tatcaaggtagcgaaatctatggaggtttagcaaatacatgagattatggacctttaggt
tcacttttgttaaacaatattaaaaatgaatgaattaaatattttattcataatgaagaa
aacaacttcttaattgatgcaaaaattttaatgaatccagaagtttggaaaactagtgga
catgttggaaattttagcgatcctttaattgaaaataaaatcaataacaaaagatatcgt
gctgatcatttaattgaagaatttgatcctttgatgaaaatcgaaactttaagtgaaatc
gaaatggaaaattttattaaaagaaatattactaaatacgaaggagttgcaactgattga
acaagtattagaaaatttaatttaatgtttgaaacttatcaaggaattttagaagattca
aaaaataaaatttatttaagacctgaaactgcacaagctatttttgttaattttaaaaat
attttaagaactacaagaactaaaattccttttggagttggtcaaattggaaaaagtttt
agaaatgaagtaactccaggtaattttatttttagaacaagagaatttgaacaaatggaa
ttagaatattttgttcatcctaatgattctgacaaagcttttgaatattatttaaaaaaa
tgttatgaatttttgatatttttaggaattaaaaaagatttattgaaaattagaaaacat
gctaaggaagaattatctcattattctagtgctacaagtgatattgaatttaaatttgat
tttggttgaggagaacttttgggagtggcaaatcgtggagattttgatttgtcttcacac
tctaaagcaacaaatgaagaattatcttattttgattcaattgaaaatataacttatatt
cctcatgtaattgaaccttctatgggattagatcgtttagctcttgctattttgacttct
tcatatgaagaagaaactttagaagtagattctagagtggttttaaaattaaataagttt
ttagtaccttatcaaattgctgttttgcctttagtaaaaaaattcagtgaagaatccaaa
gaattagtcaaatgattaaaacaacataatttcagaactacttatgatgaatctgcttca
attggaaaaagatacagaagacaagatgcaattggaacatttttcgctcttacttatgat
tatcaaagtgctgaaaatcaaagttttactattagaaatagagacacaatggaacaaatt
agaattaataaaattgatttaatttcatatttaacaaaggaattgaatggaatataa

DBGET integrated database retrieval system