KEGG   Mycoplasma mobile: MMOB2930Help
Entry
MMOB2930          CDS       T00176                                 

Gene name
glpF
Definition
(GenBank) glycerol uptake facilitator protein
  KO
K02440  glycerol uptake facilitator protein
Organism
mmo  Mycoplasma mobile
Brite
KEGG Orthology (KO) [BR:mmo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmo02000]
    MMOB2930 (glpF)
Transporters [BR:mmo02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    MMOB2930 (glpF)
Ion channels [BR:mmo04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   MMOB2930 (glpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: AAT27779
UniProt: Q6KHZ7
Position
complement(361175..361945)
Genome map
AA seq 256 aa AA seqDB search
MNNLGIFFGAEFIGTLILILIGNGVVASIALKKTKATGQGFLYASFGWMTAVFLGVMVST
SVASLGNINVPNGMINPVFVIINMINKNLPIEFGFIAILAEFLGAGAAQLIVISLYWNHY
KATEDADAVGATFFTSPAIKSKWNNFYVEIIATFILVLILSFTSSVTSPTTTIGIITGAL
PGAFNVGWIIFGIAVSLGSTTGYSLNPARDLIPRILHSILPIPNKGSSNWSYSWIPSVGP
IVGGLVGMLVTPGLFY
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaataatttaggaatcttttttggtgctgaatttattggaactctaattttaatttta
attggtaatggtgttgttgcttctattgctcttaaaaaaactaaagcaacaggtcaagga
tttttatatgcttcttttggttgaatgacagcagtatttttaggggttatggtttctact
tctgttgcttctttaggaaatataaatgtacctaatggaatgattaatcctgtttttgta
attataaatatgattaacaaaaatttacctatagaatttggttttatagcaattctagct
gaatttcttggagcaggagctgcacaattaattgttatttccctatattgaaatcattat
aaggcaactgaagatgctgatgcagttggagccactttttttacaagtcctgcaattaaa
agtaaatgaaataatttttatgttgaaataattgcaacatttatcttagttttaatttta
agttttacttcttcagtaacttctccaacaacaacaataggaataataacaggagcatta
ccaggagcatttaatgttggatgaataatttttggtattgctgtatctttaggttcaaca
acaggatattcattaaatccagcaagagatttaataccaagaattttgcattctatttta
ccaattccaaataaaggttcttcaaattgatcatattcttgaattccttcagttgggcct
attgtaggtggtttagttggaatgctagtaactccaggattattttattaa

DBGET integrated database retrieval system