KEGG   Mycoplasma mobile: MMOB2950Help
Entry
MMOB2950          CDS       T00176                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mmo  Mycoplasma mobile
Pathway
mmo00564  Glycerophospholipid metabolism
mmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MMOB2950 (glpD)
Enzymes [BR:mmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MMOB2950 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 Pyr_redox_3 Thi4 NAD_binding_8 HI0933_like FAD_oxidored Pyr_redox FAD_binding_2 GDI Lycopene_cycl Mqo Amino_oxidase TrkA_N SHOCT
Motif
Other DBs
NCBI-ProteinID: AAT27781
UniProt: Q6KHZ5
Position
complement(363492..364643)
Genome map
AA seq 383 aa AA seqDB search
MKKYDVIVIGGGIIGGAITYQLSKYNLKIAVLEKNPILAGETSAANSGVLHGGFDPEPHK
IEARLNVEGVKIWKEQIFKHLIFNRAKLDTLVLAFNDEELKELKKLYDRGLENNVPKEFM
KIISMNEIISREPHVNKEVKSGLVYNDSWAIDPIGATKAFFGVAKQNGVEIHKNSKVTKI
KYENDLFSIQINDKDFLQAKVVINAAGHYSDEIAKIAGYPDFKLTTRRGEYRILSNSELS
KVNSILFMVPTIHGKGVVVAPMLDGRVMTGPSAEDGVEKNDTRLITREKFEFIERIGKKL
IPSLDFERTELTFSGSRAIDIATNDFIINSAKENINFINAAGMQSPAIAAAPAIALEIEK
LVKKTKLKLEHKKDFNPNYEVIF
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatgatgttattgttataggtggtggaataattggaggtgctataacttat
cagttatcaaaatacaatttgaaaattgctgttttagaaaaaaatcctattttagcagga
gaaacttcagctgctaatagtggagttttacatggaggttttgatcctgaacctcataaa
attgaggccaggttaaatgttgaaggcgtaaaaatttgaaaagaacaaatttttaagcat
ttgatttttaatcgagcaaaacttgatactttagttttagcttttaatgatgaagaatta
aaagaattgaaaaaattgtatgatagaggacttgaaaataatgtgcccaaagaatttatg
aaaataatttcaatgaatgaaattattagtagagaaccacatgtaaacaaagaagttaaa
agcggacttgtttataatgatagttgagcaattgatccaatcggagcaacaaaagcattt
tttggagttgcaaaacaaaatggtgttgaaattcataaaaatagtaaagttactaaaatt
aaatatgaaaatgatttattttcaattcaaattaatgataaggattttctccaagctaaa
gttgttattaatgctgctgggcattattcagatgaaattgcaaaaattgcaggatatcca
gatttcaagctaacaacaagaagaggagaatatcggattttatctaattcagagttgtca
aaagttaattcaatattatttatggttccaacaattcatggaaaaggtgttgttgtagct
cctatgttagatggaagagttatgactggaccttcagctgaagatggtgttgaaaaaaat
gatacaagattaattacaagagaaaaatttgaatttattgagcgaattggtaagaaacta
attccaagtttggattttgaaagaactgaactaactttttcaggttctagagctattgat
attgcaactaatgattttattattaatagtgcaaaagaaaatattaattttattaatgca
gctggaatgcaatctccagcaattgcagcagcacctgcaattgcattagaaattgaaaag
cttgttaaaaaaacaaaattaaaattagaacataaaaaagattttaatcctaattatgaa
gtaattttttaa

DBGET integrated database retrieval system