KEGG   Mycoplasma mobile: MMOB2990Help
Entry
MMOB2990          CDS       T00176                                 

Definition
(GenBank) expressed protein
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAT27785
UniProt: Q6KHZ1
Position
complement(370140..370682)
Genome map
AA seq 180 aa AA seqDB search
MKLFWQVKITNKEKMKLIEFLKNRIHKNKTLFNLKIDLETGEKFEFQNVIVSIKEFKKPM
FYIMKNSVFSLNAAIVYIIDNENRIMNAFFFSNNLIIVKNDKIEVKGNDKIFLLKKGKNE
FLKNKLKKSKKLLEKLNNKISLGLTGEEIILLSNSKREYEMNFLLYKNGWIINKKENYEK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaattattttggcaagtcaaaataacaaataaggaaaaaatgaaactaatagaattt
ttaaaaaatagaattcataagaataaaaccttatttaatctaaaaatcgatttagaaaca
ggtgaaaaatttgaatttcaaaatgttatagttagcattaaagaatttaaaaaaccaatg
ttttatattatgaaaaattcagttttttctttaaatgcagcaattgtttatattattgat
aatgaaaatagaattatgaatgcatttttcttttcaaacaacttaataattgtcaaaaat
gataaaatagaagtcaaaggaaatgataagatttttttgttaaaaaaaggtaaaaatgaa
tttctcaaaaataagcttaaaaaatcaaaaaaattacttgaaaaattaaataataaaatc
agtttaggacttactggtgaagaaattattttgctaagtaattctaaaagagaatatgaa
atgaattttcttttgtacaaaaatggatgaattataaataaaaaggaaaattatgaaaaa
taa

DBGET integrated database retrieval system