KEGG   Mycoplasma mobile: MMOB3000Help
Entry
MMOB3000          CDS       T00176                                 

Definition
(GenBank) expressed protein
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt Tox-REase-7
Motif
Other DBs
NCBI-ProteinID: AAT27786
UniProt: Q6KHZ0
Position
complement(370648..371508)
Genome map
AA seq 286 aa AA seqDB search
MKIGSNSKKILTLKKIHSLIKVSKLKSLAEIAKFNKNFLNRFENALFYRDLMEYFEKKYN
FENVFFNKNKEKNSKRKIAKETVLWFYLTEEYEINSFSYESLNKELLAKFDKKNDIFIPI
GEDAIKFAKENQINSLIEFKDNKSENLVENLNTILYSIYVNGNAKAIKFVLNTNKTKDKI
VTVLPIKELELEVSNYEHEKDEDISNYKFYPSILEVNKNIVYSYLTNILSALISESRFYT
VKQKYAKQNDLLKNIEEKIDELKFVEISNKRKQLTDEIILASQNNK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataggaagtaattcaaaaaaaattttaactttgaaaaaaattcactctttaatt
aaagtaagcaaattaaaatctcttgctgaaattgcaaaatttaataagaattttttgaac
agatttgaaaatgctttattttatagagacttgatggaatattttgaaaaaaaatataat
tttgaaaatgtattttttaataaaaacaaggaaaagaattcaaaaagaaaaattgctaag
gaaacagtgttgtgattttatttgacggaagagtatgaaatcaattctttttcatatgaa
agtttgaacaaagaattacttgcaaaatttgataagaaaaatgatatttttatcccaatt
ggtgaagatgcaataaaatttgctaaggaaaatcaaataaattctcttatcgaatttaaa
gataataaatctgaaaatcttgtagaaaatttaaataccattttatattctatttatgtt
aatggaaatgctaaagctattaaatttgttttgaacacaaataaaacaaaagacaaaata
gttactgtcttaccaattaaagaattagaattagaagtaagtaattatgaacatgaaaaa
gatgaagatatttccaattataaattttacccttcgattttagaagtgaacaaaaacatt
gtatatagctatttaacaaatatactatcagctttaatttcagagtctcgtttttataca
gttaaacaaaaatatgcaaaacaaaatgatttattgaaaaatattgaagaaaaaattgat
gaattaaaatttgtagaaataagcaataaaagaaaacaattaacagatgaaattattttg
gcaagtcaaaataacaaataa

DBGET integrated database retrieval system