KEGG   Mycoplasma mobile: MMOB3040Help
Entry
MMOB3040          CDS       T00176                                 

Gene name
rplU
Definition
(GenBank) 50S ribosomal protein l21
  KO
K02888  large subunit ribosomal protein L21
Organism
mmo  Mycoplasma mobile
Pathway
mmo03010  Ribosome
Module
mmo_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mmo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MMOB3040 (rplU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmo03011]
    MMOB3040 (rplU)
Ribosome [BR:mmo03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    MMOB3040 (rplU)
  Bacteria
    MMOB3040 (rplU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L21p
Motif
Other DBs
NCBI-ProteinID: AAT27790
UniProt: Q6KHY6
Position
374176..374475
Genome map
AA seq 99 aa AA seqDB search
MFAIIETGGKQILVKKDDFIFIEKIEGEAGQNVVFDKVLLVDDKIGTPFLKNATVTGIIE
KQGKQKKIVVYRHNAKSTHKRKLGHRQPYTRVKILEIKG
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaattattgaaacaggtggaaagcaaattcttgtaaaaaaagatgatttcatt
tttattgaaaaaattgaaggtgaagcaggtcaaaatgtagtttttgataaagtactttta
gttgatgataaaattggaactccctttttaaagaatgctactgtaactggtattatagaa
aagcaaggtaaacaaaaaaagattgttgtttatcgtcataatgccaaatcaactcacaaa
agaaaattagggcaccgtcagccttatactagagtaaaaattttagaaattaaaggataa

DBGET integrated database retrieval system