KEGG   Mycoplasma mobile: MMOB3050Help
Entry
MMOB3050          CDS       T00176                                 

Gene name
rpmA
Definition
(GenBank) 50S ribosomal protein l27
  KO
K02899  large subunit ribosomal protein L27
Organism
mmo  Mycoplasma mobile
Pathway
mmo03010  Ribosome
Module
mmo_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mmo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MMOB3050 (rpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmo03011]
    MMOB3050 (rpmA)
Ribosome [BR:mmo03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    MMOB3050 (rpmA)
  Bacteria
    MMOB3050 (rpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L27
Motif
Other DBs
NCBI-ProteinID: AAT27791
UniProt: Q6KHY5
Position
374479..374736
Genome map
AA seq 85 aa AA seqDB search
MAKTKSGGSTSNGRDSKGRRLGQKLGDGQFALAGSIIYRQRGTKIHPGENVGIGKDHTLY
TLIDGYIKYAIKRNRKYASAFEERK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagacaaaatcaggtggatcgacaagtaatggtcgtgatagtaaaggtagaaga
ctaggtcaaaaacttggagatggacaattcgctttagcaggttcaattatctatcgtcaa
agaggaacaaaaattcacccaggtgaaaatgttggtattggtaaagatcatactttgtac
actctaattgatggatatatcaaatatgctataaagcgtaatagaaaatatgcttcagct
tttgaagaaagaaaataa

DBGET integrated database retrieval system