KEGG   Mycoplasma mobile: MMOB3060Help
Entry
MMOB3060          CDS       T00176                                 

Definition
(GenBank) expressed protein
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAT27792
UniProt: Q6KHY4
Position
complement(374753..375724)
Genome map
AA seq 323 aa AA seqDB search
MILQYICKTIASKENKMEDLNLKKFANDLWKKNFGNKDVVKDFTGTYIVKEEFNTGKRYS
WNLDKYDENFQEYYIANELFILQRNSQESFSFNNVNYFVDSDETGNFFNSKDLLLNVENI
KNIDSSIKNDLDKTQSIKYSALIITLKMIKPQFQNIVTNYFFRISKSYNFVNIFCEKDVD
KLIIKILFNEDVHKTLDLSLIFSSSLPLLMHRISKKFKEEPFLYNDYVLRGKFFNIFVLY
FESKENFFVLNSLNNTALYLLTFENLIFVTENSYLKLQSKIYSPNDFSLPLEISPIIKLY
SFDYANKSFVQYLKNIKREDNKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgattttgcaatatatatgcaaaacaatagcttcaaaggagaacaaaatggaagatctt
aatttaaaaaaatttgcaaatgatttatgaaagaaaaattttggaaataaagatgttgta
aaagattttacaggaacttatattgtaaaagaagaattcaatacaggtaaaagatattct
tgaaatttagataaatatgatgaaaattttcaagagtactatattgctaatgaattattt
attttacaaagaaattcccaagaatctttttcatttaataatgtaaattattttgtagat
agtgacgaaacaggaaattttttcaattcaaaagatttacttttaaatgttgaaaacatt
aaaaatattgattcgagtattaaaaatgatttggataaaacgcaatctattaaatactct
gctttaattattactttaaaaatgattaagcctcaatttcaaaatattgtcacaaattat
tttttcagaatttctaaaagctacaattttgtaaatatcttttgtgaaaaagatgtagat
aaactcataatcaaaattttatttaatgaagatgttcataaaactttagatttatcttta
attttttcttcaagtctccctcttttaatgcatagaataagtaaaaaattcaaagaggaa
ccttttttatataatgattatgttttaagaggaaaattttttaatatttttgttctttat
tttgagtctaaagaaaacttttttgtgttaaattcattaaataatacggctttatattta
cttacatttgaaaatttaatatttgttacagaaaattcttatttgaaattacaaagtaaa
atttatagtccaaatgattttagtttgcctttagaaattagtcctattattaagttatat
agttttgattatgctaataagagttttgttcaatacttaaaaaatattaaaagagaagat
aataaaaaataa

DBGET integrated database retrieval system