KEGG   Mycoplasma mobile: MMOB3080Help
Entry
MMOB3080          CDS       T00176                                 

Definition
(GenBank) expressed protein
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAT27794
UniProt: Q6KHY2
Position
complement(377398..378243)
Genome map
AA seq 281 aa AA seqDB search
MDKLKKRHFYNGIDYVLDGESKKLILLKEFHEKLLNKTLWGSFGFKKIGGSNIGDVLLKN
EKFHSEFSAFAKISYLNLPILDPKYVNAGIMIEPKVIEAIEQISNYKVQTFDPKKYNYDY
FSDKDEIVGGIPDGYVEEKKIILEIKTTKESNFENWEKYGVPNSYLKQSQLYSFLMGVEE
FAIVATFLKNEDYENPENYPIKKRKIKSYKYKINKEQVLDDLEKVKNWYHKHTKTGVSPE
YNVIEDKDLLDYLKCQNEEEWLNLLKKWDSEGKVKVEYGNW
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggataaactcaaaaaaagacacttttataatggtattgattatgtattggatggcgag
tctaaaaaactaattttattaaaagaatttcatgaaaaacttttaaacaaaactttgtga
ggaagttttggatttaaaaaaattggaggaagtaatattggtgatgttctattaaagaat
gaaaaatttcattctgaattttctgcatttgctaaaatttcatatttaaatttgcctatt
ttagatccgaagtatgtaaatgctggaataatgattgagccaaaagtaattgaggcaata
gaacaaataagcaattataaagttcagacttttgatccaaaaaaatataattacgattat
tttagtgataaagatgaaattgtaggtggaatccctgatggatatgtcgaagaaaaaaaa
ataatcttagaaattaaaacaacaaaagaatctaattttgaaaattgagaaaaatatggt
gttccaaattcttatttaaaacaatcgcaattatattcttttttaatgggtgttgaagaa
ttcgcaattgttgcaacttttttgaaaaatgaagattatgaaaatccagaaaattatcca
atcaaaaaaagaaaaataaaatcatataaatacaaaataaataaagagcaagtattagat
gatttagaaaaagttaaaaattgatatcataaacatactaaaacaggagtttctcctgag
tacaatgttattgaagataaagatcttttagattatttaaaatgtcaaaatgaagaagaa
tgacttaatcttttgaaaaagtgagattcagaaggtaaagtaaaggttgaatatggaaat
tgataa

DBGET integrated database retrieval system