KEGG   Mycoplasma mobile: MMOB3160Help
Entry
MMOB3160          CDS       T00176                                 

Definition
(GenBank) expressed protein
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipoprotein_17
Motif
Other DBs
NCBI-ProteinID: AAT27802
UniProt: Q6KHX4
Position
complement(388142..392527)
Genome map
AA seq 1461 aa AA seqDB search
MNPKTKKKVLIGSLVTSIVIIPVAITSTTLSILEKDKNESEAFLRKNLELVNRIDFNNLG
FDKNLLPENIFPTNLASHFLNHLPEKNLIEYDFIILNNLNINSIEFQIKGFYKNIEFKTQ
EFNLELNSISTIIENYLNKLKNFNLNENSLEIEKRKKINPLKINSSNINKFIDEEKILSL
PKMQKDFTYSFEYIENSSDFIEGTLKIRAWILYKNEKFSISNNPMELSLKNFLTTKKYFE
NTKQTLLNKSEKLELQVSGLLSETLPSIIEKNSDITTLIKNFLNLNEQDVSYIFTNFIPN
DKEGTLKINVNLSYLNQFENFEICISNFRNNISINELNQLISEIIITPNENLIVKDFSEF
NNGHFDEQFLKQKGISLSLQHPISIKSITNLEFKNSNENQGSTTVILTFKNTLLSNHTFI
HKINLSGFQKSDELTRLEKLVLKNESIFVLKKNDILIENELVNQEHLKINYGIRLENIDE
NLFSLIDFIEIKNTNITEGSAEIEITLKNNLGSFTRRYFEFKKGTKFDLLQYTTFEILPN
SFAPLKQTIFKPSIEKIKHLNINFNFIEKLSFEDLEKIEISNNENGSISVEILIFNDKSK
TFIISGFASQTLKDIFENLILKIDKSKEAIDILIIPENGSDFINSKQLQEIGISLNTIDD
ESILKKIGISSIKFENSNKRLGFVGKIEIRSKILNLTKTFNNVNGFFINPLFVGIDRLKI
RSINESTLDKLELIIPKNNTFHITKEQLSNAGIEIDFNEIVSLEDVLFIRFFHSQTINKL
DVNRIFINVQIQLKNSDVNKTFNDLLFKTNLENSLNRLNINVLPQTISKNTYLIASDNFE
ENKNWLNNQIGLEISTLDNLDNILNWSSILSIELKQDLFQEQFASLEIKLKNGLSRTIFL
SGFATTLNEINKMEIRALSTVFPKDTYIFILENQNSITEIQLANAGLEINFMNDSILSLK
DIEVIKIDSSSIFGSASVLIYFKNGLSKKLNVIGFKRDEFAINLQSLRLTTINSNIPLVK
QEIIIQSTKEKLITFDDLSFQNLRISNPILLKDISEIKINPNNFDLGIASVLIIFKNGIE
KNLSVSGFKTHDLIKALDDIEISGNNLKIAKNIIIVPNTTIGNTNITIEQLNSIGLNLKF
NDFLNLSHFSKIEIMNTIFGNPTINISLKDLNYTKTFNNVLGFRKNSILGSWNASSILGN
NTKILTSSKTIWILNGNQNITQTQLDELGIMLNLAIGASINDIESISISPINNSSNAFIS
IRLKIDNIIIRFNDVSGFLKIESNKLVNLRNSFVATINKSFYPNEIITILKNDQGFISQD
DLDKNNLRIAFANNISLNDIDQIQIIPNFSDHSVSIKISLKNDLGFHTFTNITDYLENEK
IASFNKSFVALINSDSFGKNFNLSIDNGFVFSEISLRENNLKLFLFDENFTYEHIKTINV
TKISNSIHIVITLDNGFVKIF
NT seq 4386 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaaaaactaagaaaaaagttttaattggctcattagtaacttctattgttatt
atacctgtagctataacttcaacaactttatctatattagaaaaagacaaaaatgaaagt
gaagcttttttaagaaaaaatttagagcttgtaaatcgaatcgatttcaataatttgggt
tttgacaaaaatttacttcctgaaaacatttttccgacaaatttagcaagtcattttttg
aatcatttacctgagaaaaatttaatagaatatgattttataattcttaataatttaaat
attaattcgattgaatttcaaatcaaaggattttataaaaatattgagttcaaaacacaa
gaattcaatcttgaattaaattcaatttctacaattattgaaaattatttgaataaatta
aagaattttaatttgaatgaaaattctcttgaaattgaaaaaagaaaaaaaatcaatcct
ttaaaaatcaatagttcaaatattaataaatttatagacgaagaaaaaattttaagttta
ccaaaaatgcaaaaagattttacttattcttttgaatatattgaaaatagttcagatttt
atagaaggaactttaaaaataagagcttggattttatataagaatgaaaaattttcaatt
tcaaataatccaatggaattatcattgaaaaactttttaactacaaaaaaatattttgaa
aacacaaaacaaactttattaaataaaagtgaaaaacttgaattgcaagttagtggatta
ttaagtgaaacattaccttctatcattgaaaaaaattcagatattactactttaattaaa
aattttttgaacttaaatgaacaagatgtttcatatatttttacaaattttatacctaat
gataaagaaggaactttaaaaataaatgtaaatttaagttatttaaatcaatttgaaaat
tttgaaatatgtatatcaaattttagaaacaatataagtattaatgaattgaatcaattg
atttcagaaataattattactccaaatgaaaatttaattgtaaaagatttttcagaattc
aataatggccattttgatgagcaatttttaaaacaaaaagggataagtctttctttgcaa
caccccatttcaattaaaagtattacaaacttagaatttaaaaattcaaatgaaaatcaa
ggaagcacaacagttattttgacatttaaaaatacacttctttcaaatcatacttttatt
cataaaataaatcttagtggttttcaaaaatctgatgaattaacaagacttgaaaaactt
gttttaaaaaatgaatcaatttttgttcttaaaaaaaatgacatattaattgaaaatgaa
cttgtcaatcaagaacacttgaaaattaattatggtattagacttgaaaatattgatgaa
aatttatttagtttaattgattttattgaaattaaaaataccaatataacagaaggtagt
gcagaaatagaaattactttaaaaaataatttaggttcttttactagaaggtatttcgaa
tttaaaaaaggaacaaaatttgatttacttcagtacacaacttttgaaattttaccaaat
agttttgcacctttaaagcaaactatttttaaaccttcaatcgaaaaaataaaacacctt
aatattaatttcaattttatagaaaaactttcttttgaagatcttgaaaaaattgaaatt
tcaaacaatgaaaatggctcaattagtgttgaaattcttatttttaatgataaaagtaaa
acatttatcatttcaggatttgcgagtcaaacattaaaagatatttttgaaaatcttatt
ttaaaaattgataaatcaaaagaagcaatagatattttgataattcctgaaaacggatca
gattttattaattcaaaacaattgcaagaaatcggcatttctttaaacactattgatgat
gaatcaatattaaaaaaaattggaatttcaagcattaaatttgaaaattcaaataaaaga
ttaggttttgttggaaaaattgaaataagatcaaaaattctaaatttaacaaaaactttt
aacaatgttaatggattttttatcaatccattatttgttgggatagataggttgaaaata
agatctattaatgaatcaactttagataaattagaattaattattcctaaaaataacact
tttcacattacaaaagaacaactatcaaatgcaggaattgaaatagattttaatgaaatt
gtgagtcttgaagatgttttatttattagattttttcattctcaaacaattaataaatta
gatgtgaatagaattttcattaatgttcaaattcaattaaaaaattctgatgtgaataaa
acttttaatgatttattatttaaaactaatttagaaaattcattaaataggttaaatatt
aatgtcttgcctcaaacaatttcaaaaaatacttatttaattgcttctgataattttgaa
gaaaataaaaattgattaaataatcaaataggtttagaaatttcaaccttagataattta
gataatattttaaactgatcttcaattctttcgattgaattaaaacaagatctttttcaa
gagcaatttgctagtttagaaattaaattaaaaaatggtttatcaagaacaatttttctt
tcaggttttgcaactactttaaatgaaattaataaaatggaaattagagctttaagtaca
gtttttccaaaagatacttacatttttattttagaaaatcaaaattctattacagaaatt
caattagcaaatgctggactagaaataaattttatgaacgattctattttaagtcttaaa
gacattgaagtcatcaaaattgattcttcatccatttttggaagcgcaagtgtacttatt
tattttaaaaatggtttatcaaaaaaattaaatgtaattggttttaaaagagatgaattt
gcaataaatttacaatctttaagacttacaacaataaattcaaatattccattagttaaa
caagaaataattattcaaagtactaaagaaaaattaataacatttgatgatttatcattt
caaaatttaagaatttcaaatccaatattattaaaagatattagtgaaatcaaaattaat
ccaaataattttgatttaggcattgccagtgttttaataatttttaaaaatggcattgaa
aaaaatctttctgtttctggatttaaaactcatgatttaatcaaagctttagatgatatt
gaaatttccggaaataatttaaaaatagctaaaaatattatcattgttccaaatacaaca
attggaaatactaatattacaatcgaacaattaaatagtattggtcttaatttgaaattt
aatgattttttaaatttatctcattttagtaaaatagaaataatgaatactatttttgga
aatcctacaattaatatttcattaaaagatttaaactacaccaaaacatttaataatgtt
ttgggttttaggaaaaactctattttgggcagctggaatgcttcaagtattttaggtaat
aatactaaaattttaacatccagtaaaacaatttgaattttaaatggaaatcaaaatata
actcaaacacaattagatgagcttggaattatgttaaatcttgcaataggagcatcaatt
aatgatattgaatctataagtataagtccaataaataattcttccaatgcttttatatca
ataagattgaaaattgacaacatcattattagatttaatgatgtttcaggatttttaaaa
attgaatcaaataaattagtgaatttaagaaattcttttgttgcaacaataaataagagt
ttttatccaaatgaaataattactattttaaaaaatgatcaaggttttattagtcaagat
gatttagataaaaataatcttagaattgcttttgctaataacatttctcttaatgacatt
gatcagattcaaatcatacctaatttttcagatcatagtgtaagtatcaaaatttcttta
aaaaatgatttaggattccatacttttacaaatattactgattatttagaaaatgaaaaa
attgctagttttaataagtcttttgttgcgttaattaattctgattcatttgggaagaat
tttaatttatcaattgataatggatttgtttttagtgaaatttctttaagagaaaacaat
ttaaaattgtttttattcgatgaaaattttacttatgaacatattaaaacaattaatgtt
acaaaaatttctaattcaattcatattgtaattactttagacaatggttttgttaaaatt
ttttag

DBGET integrated database retrieval system