KEGG   Mycoplasma mobile: MMOB3170Help
Entry
MMOB3170          CDS       T00176                                 

Gene name
pheS
Definition
(GenBank) phenylalanyl-tRNA synthetase alpha subunit
  KO
K01889  phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
mmo  Mycoplasma mobile
Pathway
mmo00970  Aminoacyl-tRNA biosynthesis
Module
mmo_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    MMOB3170 (pheS)
Enzymes [BR:mmo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     MMOB3170 (pheS)
Amino acid related enzymes [BR:mmo01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   MMOB3170 (pheS)
Transfer RNA biogenesis [BR:mmo03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MMOB3170 (pheS)
 Prokaryotic Type
    MMOB3170 (pheS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2d Phe_tRNA-synt_N tRNA-synt_2
Motif
Other DBs
NCBI-ProteinID: AAT27803
UniProt: Q6KHX3
Position
complement(392529..393518)
Genome map
AA seq 329 aa AA seqDB search
MKKNLTNLRIETLEDLKIAKSNFLNNDLELKQLMNDLKLASKEQKASIGQKINFYKQEIE
QFFLTKKEEIEKKEVLKKIQDEFIDVFEEVNFSSSLHPLTLIENRFRTWFLNNGYYETEG
SEITTDKINFELLNIPKDHPSRDMQDSLYLEKEQNGDQLLLRTHNTGFSIIELIKNKNKA
FSAFSIGKVYRNDEDDNTHSHQFSQVDVIVAGKYNFPNLMWLLKSLLSYVFEEEVKIRLR
PSYFPFTEPSCEVDVFYKNKWIEVLGSGIIHENVMKAAGYTNDMNALAWGIGIERIAMIK
YGIDNIREFYKNDIRFLKQFNLEIEKLEV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaatttgactaacttaagaattgaaactttagaagatttaaaaattgccaaa
agtaattttttaaacaatgatttagaattaaagcagttgatgaatgatttaaaacttgct
tctaaagaacaaaaagcatcaataggacaaaaaataaatttttataaacaagaaattgaa
caattttttttaacaaaaaaagaagaaatagaaaaaaaagaagttcttaaaaaaattcaa
gatgaatttattgatgtttttgaagaagttaatttttcatcttctttacacccactaact
ttaattgaaaatcgttttagaacttggtttttaaataatggttattatgaaacagaagga
agcgaaatcacaactgataaaattaattttgaattattaaacatacctaaagatcatcct
tcaagagatatgcaagattctttatatttagaaaaagaacaaaatggagatcaattgctt
ttaagaactcataatacaggttttagtattattgaattgatcaaaaataaaaacaaggct
ttttctgctttttcgattggaaaagtttatagaaatgatgaagatgataacactcactct
catcaattttctcaagttgatgtaattgttgcaggaaagtataattttccaaatttaatg
tgattattaaaatctttacttagttatgtttttgaagaagaagtgaaaattagattaaga
ccttcttattttccttttacagaaccaagttgtgaagttgatgttttttacaaaaataaa
tgaattgaagttttaggttctggaattattcatgaaaatgttatgaaagctgctggatat
actaatgacatgaatgcattagcttgaggaattggaatcgaaagaattgcaatgattaaa
tatggaattgataacattcgtgaattttataaaaatgatattagattcttaaaacaattt
aaccttgaaattgaaaaactagaggtgtaa

DBGET integrated database retrieval system