KEGG   Mycoplasma mobile: MMOB3200Help
Entry
MMOB3200          CDS       T00176                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mmo  Mycoplasma mobile
Pathway
mmo00010  Glycolysis / Gluconeogenesis
mmo00030  Pentose phosphate pathway
mmo00051  Fructose and mannose metabolism
mmo00052  Galactose metabolism
mmo00680  Methane metabolism
mmo01100  Metabolic pathways
mmo01110  Biosynthesis of secondary metabolites
mmo01120  Microbial metabolism in diverse environments
mmo01130  Biosynthesis of antibiotics
mmo01200  Carbon metabolism
mmo01230  Biosynthesis of amino acids
mmo03018  RNA degradation
Module
mmo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMOB3200 (pfk)
   00030 Pentose phosphate pathway
    MMOB3200 (pfk)
   00051 Fructose and mannose metabolism
    MMOB3200 (pfk)
   00052 Galactose metabolism
    MMOB3200 (pfk)
  Energy metabolism
   00680 Methane metabolism
    MMOB3200 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MMOB3200 (pfk)
Enzymes [BR:mmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MMOB3200 (pfk)
Protein phosphatases and associated proteins [BR:mmo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MMOB3200 (pfk)
Messenger RNA biogenesis [BR:mmo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MMOB3200 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DUF1827 DAGK_cat AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AAT27806
UniProt: Q6KHX0
Position
395381..396358
Genome map
AA seq 325 aa AA seqDB search
MAKKIAILTSGGDSPGMNNAIRTIVKTSKIHGIEVFLVYNGYKGLVEKTIKNANEINVDQ
YIGSGGTFIGSARYLEFKKLEVRQKAVQNLKEMGIDSLVVIGGDGSYAGAQLLHELGVKT
IGLPGTIDNDIASTEYTIGLDTALNTIVENVDRLRDTMNSMNMVALVEVMGHGAGDLAML
SGLATGAEIIVTNAHRKSIDEMIEIVKDQMIAKTKRSVIGIVSEFIYDDLKKVAKEIEDK
TGIRTRAIILAHTQRGGNPKAYERINASFLGIAAVESLLKNESGVALGFKGNKIISTPIP
EALKAQNSAKNENELVTKINKINQS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaaatagcaattttgacctctggaggagattctcctgggatgaataatgca
ataagaacaattgttaaaacttctaaaattcacggaattgaagtttttcttgtttataat
ggttataaaggacttgttgaaaaaacaattaaaaatgcaaatgaaattaatgtagatcaa
tacattggaagtggtggaacttttataggatctgctcgttacttagaattcaaaaaatta
gaagtaagacaaaaagctgttcagaacttaaaagaaatgggtattgattcacttgtagtt
attggtggtgatggaagttatgctggagcacaattattacatgaattaggtgtgaaaaca
ataggtttacctggaacaattgataatgatattgcttcaacagaatatactattggttta
gacacagctctaaatacaattgtagaaaatgttgatagattaagagatacaatgaatagc
atgaatatggttgctttagttgaagttatgggacatggagctggagatttagcaatgctt
agtggtttagcaacaggagctgaaattattgttacaaatgctcatagaaaatctattgat
gaaatgattgaaattgttaaagatcaaatgattgcaaaaacaaaaagatcagtaatcgga
attgttagcgaatttatttatgatgatttaaaaaaggtagctaaagaaattgaagataaa
accggaattagaacaagagcaattattttagctcatactcaaagaggcggaaatcctaaa
gcatacgagagaataaatgcttcatttttaggaattgctgcagtagaatcgttattaaaa
aatgaaagtggtgtagctctaggttttaaaggtaataaaattatttcaacaccaattcca
gaagctttaaaagcacaaaattcagctaaaaatgaaaatgaattagtaactaaaatcaat
aaaataaatcaatcataa

DBGET integrated database retrieval system