KEGG   Mycoplasma mobile: MMOB3210Help
Entry
MMOB3210          CDS       T00176                                 

Gene name
pyk
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
mmo  Mycoplasma mobile
Pathway
mmo00010  Glycolysis / Gluconeogenesis
mmo00230  Purine metabolism
mmo00620  Pyruvate metabolism
mmo01100  Metabolic pathways
mmo01110  Biosynthesis of secondary metabolites
mmo01120  Microbial metabolism in diverse environments
mmo01130  Biosynthesis of antibiotics
mmo01200  Carbon metabolism
mmo01230  Biosynthesis of amino acids
Module
mmo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMOB3210 (pyk)
   00620 Pyruvate metabolism
    MMOB3210 (pyk)
  Nucleotide metabolism
   00230 Purine metabolism
    MMOB3210 (pyk)
Enzymes [BR:mmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     MMOB3210 (pyk)
Membrane trafficking [BR:mmo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MMOB3210 (pyk)
Exosome [BR:mmo04147]
 Exosomal proteins
  Proteins found in most exosomes
   MMOB3210 (pyk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK HpcH_HpaI PK_C HAS-barrel
Motif
Other DBs
NCBI-ProteinID: AAT27807
UniProt: Q6KHW9
Position
396371..397822
Genome map
AA seq 483 aa AA seqDB search
MNVLEKEKGVNLTDKRSKMIATIGPSSQNKEILKQMMLKGMTTVRANFSHGDHAEQLNKF
VLAKEVAKELNLPMSLMLDTKGPEIRVGKMKDGSQKIEVGKIITVLTDEVSYKTFEGIPT
KFTVSHRMDKDVKVGSYILFDDGKLTTIVTGVKSGIVEVKTINSHVLKSNKRINIPGAQL
SLEFLSKKDKEDIIFGIKNDVNYIAASFVNSKQDVLDLRKLLKDNNGEHIQIISKIESVF
GIENIDEIIEASDGIMIARGDLGLEIPYFEVPFYEKQIIRKCRNVGKPVIVATQMLDSME
KLPQPTRAEVSDVYWATELGADATMLSGESANGDFPVESVEVMSTINRRAEKEFYNKLYY
PAHLETLIQNPVGVHSKLASEVALKVMNGDYKFSVILSETGRLLKEIARFRPNTVIIGVI
NNDKLIHGFGITHSVFMSVDSKAVKSEIEKNLTKAREVLKPFFPKKGDKYLVVENNKISE
YIY
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtattagaaaaagaaaaaggtgttaatcttactgataaaagatcaaaaatgatc
gctacaattggtccatcttcacaaaataaagaaattttaaaacaaatgatgttgaaaggt
atgactacagttagagccaattttagccatggagatcatgcagaacaactaaataaattt
gttttagcaaaagaagtagcaaaagaactaaatttaccaatgtctcttatgttagacact
aaaggtcctgaaattagagttggaaaaatgaaagatggatctcaaaaaattgaagtaggg
aaaattattaccgttttaacagatgaagtttcatacaaaacttttgaaggaattccaact
aaatttacagtttcacatagaatggataaagatgttaaagttggaagctacattttattt
gatgatggaaaattaactactattgttacaggtgtaaaatcaggaattgtcgaagtaaaa
acaattaattcacatgttttaaaatcaaataaaagaattaatattccaggagctcaatta
tcattagaatttttaagtaaaaaagataaagaagatattatctttggaattaaaaatgat
gtaaattatattgctgcttcatttgttaattcgaaacaagatgttcttgatttaagaaaa
ttattaaaagataataatggagaacatattcaaattatttcaaaaattgaatctgtattt
ggaattgaaaatattgatgaaattattgaagctagtgatggaatcatgatcgcaagagga
gatttaggattagaaattccttattttgaagttcctttttatgaaaaacaaattattaga
aaatgtcgtaatgttggtaaaccagttattgttgcaactcaaatgcttgattcaatggaa
aaactacctcaaccaactagagcagaagttagtgatgtttactgggcaacagaattagga
gcagatgcaactatgctttcaggagaaagtgcaaatggagatttccctgttgaatcagtt
gaagttatgtcaacaattaatcgtcgtgcagaaaaagaattttacaataaattatactat
cctgcacatttagaaactttaattcaaaatccggttggagttcactcgaaattagcttct
gaagttgcacttaaagtaatgaatggagattataaattttcagttattctttcagaaaca
ggaagattattaaaagaaattgcacgttttagacctaatacagttattatcggagttatt
aacaatgataaattaattcatggatttggaattacacacagtgtgtttatgagtgtagat
tcaaaagcagtaaaaagtgaaattgaaaaaaatcttactaaagcaagggaagttttaaaa
ccatttttccctaaaaaaggtgacaaatatttagttgttgaaaataataaaatttcagaa
tatatttattaa

DBGET integrated database retrieval system