KEGG   Mycoplasma mobile: MMOB3220Help
Entry
MMOB3220          CDS       T00176                                 

Gene name
mvspB
Definition
(GenBank) variable surface protein mvspB
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipoprotein_17
Motif
Other DBs
NCBI-ProteinID: AAT27808
UniProt: Q6KHW8
Position
complement(398037..399923)
Genome map
AA seq 628 aa AA seqDB search
MNMNKKNMILGSIATIMGTATIVGPIVSLPQQKIDNNLIQANLQNELDKISTLKTTNLAS
STLPSNVDNANIDTFLVKPNSINGVNFTLKVQNPSISNDDNGTIDVILEAQLNNLVLSKV
ITVLGFKSLSDQINLQNELDKITTLELTNLASSTLPSNVDNANIDTFLVKPNSINGVNFT
LKVQNPSISNDDNGTIDVILEAQLNNLVLSKVITVSGFKSLNEQNLKNELDKITTLELTN
LASSTLPSNVDNANIDTFLVKPNSINGVNFTLKVQNPSISNDDNGTIDVILEAQLNNLVL
SKVITVSGFLKMINFEFNRINTLELNQNAKGSLPSFPNEQNLSSFINVPITNSNVTFSVS
FPQNMEAANNLDGTLDVILTASQIGQQSISKSIKTVGWFTSLNLIRAIRNPAILSDLDRD
HYLEQLKNWLFTGEIGKRNFQNLYRQHHLRKLEVFNHNITTITESVNSIIETDVRITKLS
IERPTSNSNVYSLLVHYETNEPGWIETNEISGEQIRRTSGNFFFTNLGNSTIISSENNGA
LQVIPTIIKDGLAIRMEQLGLNPDPYTIYRYSFLPTISPELKASISSTDWIIYLNGNNIS
FTTTLHSGVSKPEGFDDLRFDVAMTLYG
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgaacaaaaaaaacatgattttaggatctattgcaactatcatgggaacagca
acaattgtaggaccgattgtttctttacctcaacaaaaaatagataataatctaatacaa
gctaatttacaaaatgaattagataaaatttctactttaaaaactactaatttagcatct
tcgactttaccttcaaatgtagacaatgctaatattgatacatttttagttaaacctaat
tcaataaatggtgttaattttactttgaaagttcaaaatccaagcatttctaatgatgat
aatggaacaattgatgtaattttagaagctcaattaaataatttagttttatcaaaagtt
attactgttttgggatttaaatctttaagtgatcaaattaatttgcaaaatgaattagat
aaaattactactttagaacttactaatttagcatcttcgactttaccttcaaatgtagac
aatgctaatattgatacatttttagttaaacctaattcaataaatggtgttaattttact
ttgaaagttcaaaatccaagcatttctaatgatgataatggaacaattgatgtaatttta
gaagctcaattaaataatttagttttatcaaaagttattactgtttcaggatttaaatct
ttaaatgagcaaaatttaaaaaatgaattagataaaattactactttagaacttactaat
ttagcatcttcgactttaccttcaaatgtagacaatgctaatattgatacatttttagtt
aaacctaattcaataaatggtgttaattttactttgaaagttcaaaatccaagcatttct
aatgatgataatggaacaattgatgtaattttagaagctcaattaaataatttagtttta
tcaaaagttattactgtttcaggatttttaaaaatgattaattttgaatttaatagaatc
aatactttagagttaaatcaaaatgcaaaaggctctttaccaagttttccaaatgagcaa
aatttgagttcatttattaatgttcctatcacaaattcaaatgtaactttttctgtaagt
tttccacaaaatatggaagctgctaataatttagatggaactttagatgtaattttaacg
gcttcacagataggccaacaatcaatttcaaaatcaataaaaacagtagggtgatttact
tcattaaacttaataagagcaattaggaatcctgcaatactttctgatttagatagggat
cattatctagaacaacttaaaaattgattatttacaggagaaataggtaaaagaaacttt
caaaatttatatagacaacatcatttaagaaaattagaagtttttaatcataatataaca
acaattactgaatctgtaaattcaataattgaaactgatgttagaatcactaaattaagt
attgaaagacctacttctaattcaaatgtttattcattgctagttcattacgaaactaat
gaaccgggttgaattgaaacaaatgaaataagtggagagcaaattagaagaacaagtggg
aacttctttttcacaaatctaggaaatagcaccattatttctagtgaaaataatggtgca
ttgcaagtaatacctacaattattaaagatgggcttgctattaggatggaacaattaggt
ttaaatccagatccttatactatttatagatattcctttttacctactataagtccagaa
ttaaaagcatcaatttcttcaaccgattgaatcatttatttaaatggaaataatatatct
tttacaacaacattacattcaggagtttctaaaccagaaggttttgatgatttaagattt
gatgttgccatgactttatatggttaa

DBGET integrated database retrieval system