KEGG   Mycoplasma mobile: MMOB3320Help
Entry
MMOB3320          CDS       T00176                                 

Gene name
mvspG
Definition
(GenBank) variable surface protein mvspG
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAT27818
UniProt: Q6KHV8
Position
complement(415415..415732)
Genome map
AA seq 105 aa AA seqDB search
MKITINGTFDENVVSFSKELKGFTAISSVTDTLFTFERNDQTLIANNRANNEIEDLISTN
TTNANLTAFRGIVVKIKNAWAKDVNDNLIFENNIPQFNEELHNRI
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattacaattaatggtacatttgatgaaaatgtagtaagtttttcaaaagaatta
aaaggctttactgcaattagtagtgttactgatactttatttacttttgaacgcaatgat
caaactttaattgcaaataatagagcaaataatgaaatagaggatttaatttctactaat
acaacaaatgctaatttaacagcttttagaggtattgttgttaaaataaaaaatgcatga
gcaaaagatgttaatgataatttaatttttgaaaataatatccctcaatttaatgaagaa
cttcataatagaatttaa

DBGET integrated database retrieval system