KEGG   Mycoplasma mobile: MMOB3340Help
Entry
MMOB3340          CDS       T00176                                 

Gene name
mvspI
Definition
(GenBank) variable surface protein mvspI
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipoprotein_17
Motif
Other DBs
NCBI-ProteinID: AAT27820
UniProt: Q6KHV6
Position
complement(417670..423678)
Genome map
AA seq 2002 aa AA seqDB search
MLKMKKKYLIGIGTLSAIAILPITVVACATNTSENANNIKKIDVELAKITKDNFLIKDKN
KLASEINANNLQTEITKNNATTINGVAFSYALSEKTPINAATGTLTLTLTGKIGTDSRTK
EITITGFQTISQRLKQELDKISTLKADKGNFATTLASNVTSSTLSSFVSDPASKNGVSFK
LIFLPNSFNDGLGSLSVTLEASIGTIKDSKTITITEFQTRELTLEEWKELISKELTKQNK
HEATLVGSLTTLASEVSAQNLNNFILNPVTSNGVSFRYIFKANSADDVKGELTATLQAYI
VGREPEDLDDPSQVIQPESKEVIITGFQTRAQRDLIIKTAQIKAELDKIETLTNLEASKI
VMPSEVNSTNIAGLFSPLQDQNGVSFKYLSVTSPNDDEGTLFVNIEGSIDNIKSEKMVQV
KNFQTIAQRLKQELDKISTLKADQGNFNTTLASGVSNTNLNSFIKNPATVNSVSFRLIFI
PNKFTNASGELTVNLQAFIGDKTDQKEIFITGFQSSLERVKQELDKITSTTLKVDMGDFK
TTMPSEVDANNLDSFIKNQLPSDTNDVSFRFVFLPNLFNNQKGELKVNLQAFIGNISFGK
DILITGFQTIDERAESIEQQNALIQRKLNEIVPKLINTFDTTLPSEVKPENVTKLIEIPA
IIEGVSFKITNLSLVNDKNGSLSITIEGSIGDIKISRDISIIGFQTEDQRKELDPNQRIQ
AALNNLTLVKTGAFATTLPLEVKLDNVASFFEILKPVKDVNLKFISVKSQNDTTGTLTVT
IEGSIGEIKVTKDFDIIEFQTIDQRNKAKIQVELDKINLVKTGAFATTLPLEVKVENVAS
FFNSLPIVEGINLKFINVKLQDDEVGTLTVTIEGSIGESKVTKDFDISGFQTIDQRLDQE
LAEITTIEANLSAFATTLPSTITAETLKNFISNPTTSNGVSFELIFKANSADDTKGELKV
TLKASISGISKEKEITITKFQTTDQSGNQRLDQELAKITTIEANLSAFATTLPSTITAET
LKNFISNPTTSNGVSFELIFKTNSDDDTKGELKVTLKASISGISKEKEITITKFQTIDQR
LDQELAKITTIEANLSAFATTLPSTITAETLKNFISNPTISNGVSFELIFKANSDDDTKG
ELKVTLKASISGISKEKEITITKFQTNQDHLNEIINAIKAEIFEIEKQNKLPSEIAASDI
KFIKNFDNKGVDLEILEIIPNNANGTLSFKVKGTFKGIEKSSIKIEISNFETNAKRRERI
LNEITENDIILGINNKNEILPKDINSTIISITNSTRELVALSLEITNRNDELGQITFKVV
ATLGETTDKFITMSGFLTTQEKREKDLITLQNAYNQITQQNLNINNENEIITALASSMTN
ELINKYVSINSINGVNFKLEIDSSNDTIGTLNVRVIASFEGQNLNTKILNVNNFKTANMA
FGDWLGLSNSEVNTTFFTPSVTNVQSQSNITTMRTFINQIGIMNKNIGFGDVDANRFTLT
NYRITDLNNGTTFTKDSKDMKITINGTFDGKLVNFTKELKGYTAIGTILDTLITFTRNEK
PLLTASQGNLHTGQLFEQNHLPDRGIVAKESSDWKKFFNTASGKEEFASTGEATWIPSFI
EGLHNRNLRLHANRFAWRTSAVENGEQSITIWFHFDQTLAFAGSTDYLIDTPFFTTQKIQ
QTLLQKTIDSITSEIFEIENKATKLSSSISNADIKFIQSFDKRGVNLEVIDLSRNNTDGT
LSFKVKGTFEGTERISEIITISGFLTPKDALAAILGLRNAEVDTTFFIPSRTNLVTSITT
LTDMKNKLTEIGLILKEENLGIDNNQFAITSYQLQNSTFDTTTNGHTLIVNGTFNNEAVT
YSRRIEGFKPISQDLLNRFFTIEKVGNLILTTPAAGTPANSTFTALLNPFRGVKFSLGDV
WAKDNSGAPIFENGFPRFNDELHNKGLRYAVSASAFNAVRWRHFGVDTTTNTQDWRVYVY
LDAVRAPENGHPLRWEGKVSNA
NT seq 6009 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaatgaaaaagaaatatttaattggaattggtacacttagtgcaattgcaatt
ttaccaataacagttgttgcatgtgcaactaatacatcagaaaatgctaacaatattaaa
aaaattgatgttgaacttgcaaaaattactaaagataattttcttattaaagataaaaac
aaattagcttcagaaattaatgcaaataatttacaaactgaaataacaaaaaataatgct
accactattaatggtgttgccttttcttatgctctttctgaaaaaactcctataaatgct
gccacaggtactttaactttaactttgacaggtaaaattgggaccgatagtagaactaaa
gaaatcactattacaggatttcaaactattagtcaaagattaaaacaagaattagataaa
attagtactcttaaagctgataaaggtaattttgctacaactttagcttcaaatgtaact
tcatcaactctaagtagttttgtatctgatccagcttctaaaaatggtgttagttttaaa
cttatttttcttcctaatagttttaatgatggattaggaagcttaagtgttactttagaa
gcttcaatcggaactattaaagattctaaaacaattactattacagaattccaaactaga
gaattaacacttgaagaatgaaaagaattaatctctaaagaactaacaaaacaaaataaa
catgaagcaactttagttggttctttaacaactttagcttcagaagtaagtgctcaaaat
ttaaataactttattttaaacccagtaacatcaaatggagtaagttttagatatattttt
aaagcaaatagtgctgatgatgtaaaaggtgaattaacagcaactttacaagcatatatt
gttggtagagagcctgaagatttagatgatccaagtcaagtaattcaaccagaatcaaaa
gaagttataattacaggattccaaacaagagctcaaagggacttaataattaaaactgct
caaattaaagcagaacttgataaaattgaaactctaacaaacttagaagcttctaaaatt
gttatgccttcagaagtaaattctacaaatattgctggtttattttcacctttacaagat
caaaatggtgttagctttaaatacttatcagttacttcaccaaatgatgatgaaggaact
ctttttgttaatattgaaggttctattgacaatattaagtcagaaaaaatggttcaagtt
aaaaacttccaaacaatagctcaaagattaaaacaagaattagataaaattagtactctt
aaagccgatcaaggtaattttaatacaactttagcttcaggggtatctaatacaaattta
aactcttttataaaaaatccagcaactgttaattctgtaagttttagacttatttttatt
cctaataagtttactaatgcatcaggagaattaactgttaatttacaagcttttattgga
gataaaaccgatcaaaaagaaatttttatcacagggtttcaatcatctttagaaagagta
aaacaagaattagataaaattacttctacaactttaaaagttgatatgggtgattttaaa
actactatgccttcagaagtagatgcaaataatttagatagttttattaaaaatcaatta
cctagcgatactaatgatgtaagttttagatttgtttttttacctaacttatttaataat
caaaaaggagaattaaaagttaatttacaagcttttatcggcaatatctcttttggtaaa
gacattcttattacaggattccaaacaatagatgaaagagcagaaagtattgaacagcaa
aatgcacttattcaaagaaaattgaatgaaattgttccaaaattaattaacacatttgac
acaactttaccttcagaagtaaaacctgaaaatgttactaaattaattgagattccagca
ataattgaaggagtaagttttaaaattacaaatctaagtttagtaaatgataaaaatgga
tctctaagcattactattgaaggttcgattggagatattaaaatctctagagatatttct
attataggatttcaaactgaagatcaaagaaaagaactagatccaaaccaaagaattcaa
gcagcacttaataatcttactttagtaaaaacaggtgcttttgcaactactttaccttta
gaagtaaaacttgataatgttgcttctttctttgaaattctaaaacctgtaaaagatgta
aatcttaaatttataagtgtaaaatcacaaaatgatacaacaggaacactaacagttact
attgaaggttcaattggagaaatcaaagtaactaaagattttgatattatcgaattccaa
acaattgatcaaagaaataaagctaaaattcaagtagaacttgataaaattaacctagta
aaaacaggtgcttttgcaactactttacctttagaagtaaaagttgaaaatgttgcttct
ttctttaatagtctaccgattgtagaaggtataaatcttaaatttataaatgtaaaatta
caagatgatgaggtcggaacactaacagttactattgaaggttcaattggagaatctaaa
gtaactaaagattttgatattagcggatttcaaacaattgatcaaagattagatcaagaa
ttagcagaaattactactattgaagctaatttaagtgcttttgcaactactttaccttca
acaataactgctgaaactttaaaaaactttatttctaatccaacaacatctaatggggta
agttttgaacttatttttaaagcaaatagtgctgatgatacaaaaggagaattaaaagta
actttaaaagcttctatttcaggaatttcaaaagaaaaagaaattactatcacaaaattt
caaacaactgaccaaagtggaaatcaaagattagatcaagaattagcaaaaattactact
atcgaagctaatttaagtgcttttgcaactactttaccttcaacaataactgctgaaact
ttaaaaaactttatttctaacccaacaacatctaatggggtaagttttgaacttattttt
aaaacaaatagtgatgatgatacaaaaggagaattaaaagtaactttaaaagcttctatt
tcaggaatttcaaaagaaaaagaaattactatcacaaaatttcaaacaattgatcaaaga
ttagatcaagaattagcaaaaattactactatcgaagctaatttaagtgcttttgcaact
actttaccttcaacaataactgctgaaactttaaaaaactttatttctaatccaacaata
tctaatggggtaagttttgaacttatttttaaagcaaatagtgatgatgatacaaaagga
gaattaaaagtaactttaaaagcttctatttcaggaatttcaaaagaaaaagaaattact
atcacaaaatttcaaacaaatcaagatcatttaaatgaaattattaatgcaattaaggca
gaaatttttgaaatcgaaaaacaaaataaattgccttcagaaattgctgcttctgacatt
aaatttattaaaaattttgataataagggtgttgatttagaaattttagaaataatccca
aataatgctaatggtactttaagttttaaagtaaaaggtacttttaaaggaattgaaaaa
tcttcaattaaaatagagatttctaattttgaaacaaatgcaaaacgtagagaaagaatt
ttaaatgaaattactgaaaatgatattattttaggaattaataataaaaatgaaattttg
ccaaaagatataaatagtaccattattagtattactaattcaacaagagaattagttgct
ttaagtttagaaattactaatcgtaatgatgaattaggccaaattacttttaaagttgtt
gcaactttaggtgaaacaactgataaatttattactatgtcaggctttttaacaacacaa
gaaaaaagggaaaaagatttaattacattacaaaatgcttataatcaaatcactcaacaa
aatttaaatatcaataatgaaaatgaaattattacagctttagcatcttcaatgacaaat
gaacttattaataaatatgtaagtataaattcaattaatggtgttaattttaaattagaa
atagattcatctaatgatactattggaactttaaatgtaagagttattgcttcttttgaa
ggtcaaaatttaaatactaaaatattaaatgtaaataatttcaaaacagcaaacatggct
tttggagattgacttggattatctaattcagaagtaaatactactttctttaccccttca
gttacaaatgttcaatcacaaagtaatatcaccacaatgagaactttcataaatcaaatt
ggtattatgaataaaaatataggttttggagatgttgatgctaatagattcacacttaca
aattatcgaattacagatttaaataatggtactacatttacaaaagattcaaaagatatg
aaaattacaattaacggaacttttgatggaaaattagtaaattttacaaaagaattaaaa
ggatatactgcaattggtacaatcttagatactctaataacttttacacgtaatgaaaaa
ccattattaacagcatctcaaggtaatctccacacagggcaattatttgaacaaaatcat
ctaccagatagaggaattgtagctaaagaatcatcagattgaaaaaaattctttaatact
gcaagcggaaaagaagagtttgcttctacaggtgaagcaacatgaataccttcatttatt
gaaggacttcataatagaaatttaagacttcatgctaatcgttttgcctgaagaacttct
gctgttgaaaatggagaacaaagtattactatatgattccactttgatcaaacattagca
tttgccggatcaactgattatttaattgacacacctttttttactactcaaaaaatacaa
caaactttattacaaaaaacaattgattcaattacatctgaaatttttgaaattgaaaat
aaagcaacaaaattatcttcatcaatttctaatgctgatattaaatttattcaaagtttt
gataaacgaggtgttaatttagaagttattgatttaagtagaaataatacagatggtact
ttaagttttaaagtaaaaggtacttttgaaggaactgaaagaatttcagaaataattact
atatcaggttttttaacacctaaagatgctttagcagcaatattaggactaagaaatgca
gaagtagatacaactttctttattccttcaagaaccaacttagttacaagtattacaaca
ttaactgatatgaaaaataaattgacagaaatcggtcttatattgaaagaagaaaattta
ggaatcgataataatcaatttgctattacaagttatcaattacaaaatagtacttttgat
acgacaacaaatggtcatactttaattgtcaatggaactttcaataatgaagcagtaact
tattcaagaagaattgaaggatttaaaccaatttctcaagatttattaaatagatttttc
acaatcgaaaaagttggtaatttaattcttaccactcctgctgctggtactcctgcaaat
tctactttcactgctttattaaatccatttagaggtgtaaaatttagtcttggtgatgtt
tgagcaaaagataatagtggagcaccgatctttgaaaatggattccctcgatttaatgat
gaattacataataaaggattaagatatgcagtgtcagcaagtgcattcaatgctgtgaga
tgacgccattttggtgtagacacaactacaaatacacaagactgaagagtatatgtttat
ttagatgcagtaagagcccctgaaaatggtcatccacttagatgagaaggtaaagttagt
aatgcttaa

DBGET integrated database retrieval system